Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QX28

Protein Details
Accession A0A5B1QX28    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPRQQQQQKQLRKGNRSIIRDHydrophilic
NLS Segment(s)
PositionSequence
133-145RKRRNADKAQKKR
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MPRQQQQQKQLRKGNRSIIRDPIVTRSRSQLNVASCDAVPSHASGSGGPHDYLELGSQATLGAPYFPMGGLSSFRQHGQPVLAAASWAISHVKSSESETRESADPVIRARAHEKVAWAISSPKAKHQMTEEERKRRNADKAQKKRDRDVEDRVRLNNVLPEDRQAVLDRPGPVEVMRNAIEYIIELRSECVDLRAELHREQETNRVIRILIGAQETEVNSRASDCILEMQEEIRSLRARLSGQST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.78
4 0.73
5 0.72
6 0.67
7 0.61
8 0.55
9 0.54
10 0.52
11 0.47
12 0.44
13 0.41
14 0.42
15 0.41
16 0.42
17 0.39
18 0.36
19 0.38
20 0.38
21 0.34
22 0.28
23 0.27
24 0.24
25 0.19
26 0.16
27 0.12
28 0.12
29 0.11
30 0.11
31 0.1
32 0.13
33 0.15
34 0.16
35 0.15
36 0.14
37 0.13
38 0.13
39 0.13
40 0.11
41 0.08
42 0.06
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.08
58 0.1
59 0.12
60 0.13
61 0.14
62 0.14
63 0.14
64 0.15
65 0.14
66 0.13
67 0.12
68 0.12
69 0.11
70 0.09
71 0.09
72 0.07
73 0.06
74 0.06
75 0.06
76 0.04
77 0.05
78 0.06
79 0.07
80 0.07
81 0.12
82 0.18
83 0.19
84 0.21
85 0.21
86 0.23
87 0.23
88 0.23
89 0.2
90 0.16
91 0.14
92 0.14
93 0.17
94 0.15
95 0.16
96 0.17
97 0.19
98 0.19
99 0.19
100 0.19
101 0.17
102 0.17
103 0.16
104 0.14
105 0.13
106 0.14
107 0.18
108 0.18
109 0.19
110 0.26
111 0.26
112 0.27
113 0.28
114 0.35
115 0.35
116 0.46
117 0.5
118 0.52
119 0.55
120 0.58
121 0.59
122 0.54
123 0.57
124 0.56
125 0.59
126 0.61
127 0.68
128 0.75
129 0.8
130 0.79
131 0.78
132 0.77
133 0.74
134 0.68
135 0.67
136 0.67
137 0.66
138 0.64
139 0.58
140 0.51
141 0.44
142 0.39
143 0.32
144 0.24
145 0.19
146 0.16
147 0.18
148 0.18
149 0.18
150 0.18
151 0.17
152 0.16
153 0.17
154 0.2
155 0.19
156 0.18
157 0.18
158 0.17
159 0.16
160 0.18
161 0.16
162 0.16
163 0.15
164 0.15
165 0.15
166 0.14
167 0.14
168 0.1
169 0.12
170 0.08
171 0.08
172 0.07
173 0.08
174 0.09
175 0.1
176 0.1
177 0.09
178 0.1
179 0.1
180 0.13
181 0.17
182 0.2
183 0.2
184 0.24
185 0.25
186 0.25
187 0.26
188 0.32
189 0.33
190 0.32
191 0.31
192 0.28
193 0.26
194 0.25
195 0.26
196 0.19
197 0.15
198 0.14
199 0.13
200 0.13
201 0.15
202 0.15
203 0.15
204 0.15
205 0.13
206 0.12
207 0.13
208 0.13
209 0.12
210 0.11
211 0.1
212 0.14
213 0.14
214 0.15
215 0.15
216 0.15
217 0.16
218 0.17
219 0.17
220 0.16
221 0.17
222 0.17
223 0.19
224 0.22
225 0.23