Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1REP1

Protein Details
Accession A0A5B1REP1    Localization Confidence High Confidence Score 23.2
NoLS Segment(s)
PositionSequenceProtein Nature
110-129ASRLRRPTRRPHDARAIPRPBasic
155-175VTTPPPPSRQRPRRSRDAPSTHydrophilic
382-401LTTLPPSIRHPRRPHNAPAAHydrophilic
436-458FTTPPAPSSQRPRRLRNAPGALVHydrophilic
NLS Segment(s)
PositionSequence
112-148RLRRPTRRPHDARAIPRPCPLRHPSPMPPAPPSSRRR
160-168PPSRQRPRR
446-470RPRRLRNAPGALVTPVPSRRRPPRR
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MEVDEEGKTTEGKPTGKDSATAPTTGDGAAPPPASSSDASTLPQAAKPAPALDEAEPQNIPLPPVHGQAFAKAVHGVSKRSSITPYRALYTVPPLCAPARPLEPHAASAASRLRRPTRRPHDARAIPRPCPLRHPSPMPPAPPSSRRRIDAAPAVTTPPPPSRQRPRRSRDAPSTLMTPAPSPRRPRVVDDATGAVFTTPAAPSQRPRRPCDAPAVTTPPPPLRRSRRQYDTPAAHTTPSPPTRRPRGVDDTPGALVTPAPSPRRPCGVDDAARAVFTTPAAPSQCPRCPCDARAVTTPPPPPTRRPRSVDDAARAVFMTPPAPSQRPRRPCDALAVTTPPPPSRRRPRGVDDAPGALVGALVTPPPSSRRPRRPCDAPAALTTLPPSIRHPRRPHNAPAAHTTPSPPTRRPRGVDDTPGALMTPAPSPRRPRAVFTTPPAPSSQRPRRLRNAPGALVTPVPSRRRPPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.38
3 0.38
4 0.38
5 0.34
6 0.38
7 0.37
8 0.35
9 0.29
10 0.23
11 0.23
12 0.21
13 0.2
14 0.11
15 0.11
16 0.14
17 0.13
18 0.12
19 0.13
20 0.14
21 0.16
22 0.16
23 0.18
24 0.18
25 0.19
26 0.2
27 0.2
28 0.22
29 0.21
30 0.22
31 0.21
32 0.18
33 0.19
34 0.19
35 0.19
36 0.18
37 0.19
38 0.2
39 0.19
40 0.26
41 0.25
42 0.27
43 0.25
44 0.24
45 0.26
46 0.23
47 0.23
48 0.16
49 0.18
50 0.17
51 0.21
52 0.22
53 0.23
54 0.22
55 0.24
56 0.26
57 0.22
58 0.21
59 0.18
60 0.17
61 0.2
62 0.22
63 0.22
64 0.21
65 0.27
66 0.27
67 0.28
68 0.33
69 0.31
70 0.35
71 0.41
72 0.41
73 0.38
74 0.36
75 0.36
76 0.33
77 0.37
78 0.34
79 0.27
80 0.25
81 0.25
82 0.25
83 0.26
84 0.25
85 0.21
86 0.23
87 0.24
88 0.27
89 0.31
90 0.31
91 0.31
92 0.3
93 0.26
94 0.21
95 0.23
96 0.26
97 0.22
98 0.24
99 0.29
100 0.36
101 0.44
102 0.5
103 0.57
104 0.61
105 0.69
106 0.74
107 0.76
108 0.78
109 0.78
110 0.8
111 0.8
112 0.75
113 0.66
114 0.65
115 0.63
116 0.53
117 0.53
118 0.5
119 0.48
120 0.48
121 0.53
122 0.54
123 0.58
124 0.62
125 0.57
126 0.54
127 0.51
128 0.51
129 0.52
130 0.5
131 0.49
132 0.5
133 0.49
134 0.5
135 0.47
136 0.47
137 0.46
138 0.43
139 0.36
140 0.32
141 0.32
142 0.29
143 0.27
144 0.25
145 0.21
146 0.24
147 0.26
148 0.35
149 0.44
150 0.54
151 0.63
152 0.71
153 0.74
154 0.79
155 0.81
156 0.81
157 0.79
158 0.76
159 0.7
160 0.61
161 0.56
162 0.46
163 0.4
164 0.32
165 0.23
166 0.21
167 0.24
168 0.27
169 0.31
170 0.35
171 0.41
172 0.43
173 0.47
174 0.5
175 0.48
176 0.45
177 0.41
178 0.38
179 0.3
180 0.28
181 0.23
182 0.14
183 0.09
184 0.07
185 0.06
186 0.05
187 0.06
188 0.09
189 0.1
190 0.15
191 0.26
192 0.32
193 0.37
194 0.42
195 0.47
196 0.49
197 0.5
198 0.55
199 0.49
200 0.45
201 0.43
202 0.45
203 0.39
204 0.36
205 0.35
206 0.31
207 0.3
208 0.3
209 0.35
210 0.38
211 0.47
212 0.53
213 0.6
214 0.61
215 0.64
216 0.69
217 0.69
218 0.65
219 0.59
220 0.56
221 0.48
222 0.41
223 0.35
224 0.3
225 0.28
226 0.29
227 0.28
228 0.29
229 0.35
230 0.43
231 0.48
232 0.48
233 0.49
234 0.51
235 0.51
236 0.51
237 0.46
238 0.39
239 0.34
240 0.31
241 0.24
242 0.15
243 0.12
244 0.08
245 0.09
246 0.11
247 0.13
248 0.16
249 0.19
250 0.22
251 0.27
252 0.27
253 0.27
254 0.31
255 0.34
256 0.35
257 0.33
258 0.35
259 0.3
260 0.28
261 0.26
262 0.19
263 0.13
264 0.1
265 0.1
266 0.06
267 0.09
268 0.1
269 0.11
270 0.13
271 0.19
272 0.23
273 0.25
274 0.27
275 0.32
276 0.34
277 0.34
278 0.42
279 0.4
280 0.39
281 0.41
282 0.44
283 0.4
284 0.42
285 0.44
286 0.39
287 0.42
288 0.41
289 0.45
290 0.51
291 0.57
292 0.59
293 0.61
294 0.62
295 0.64
296 0.68
297 0.66
298 0.59
299 0.54
300 0.46
301 0.41
302 0.35
303 0.27
304 0.2
305 0.15
306 0.11
307 0.08
308 0.1
309 0.14
310 0.17
311 0.22
312 0.31
313 0.41
314 0.49
315 0.53
316 0.58
317 0.59
318 0.57
319 0.61
320 0.57
321 0.49
322 0.43
323 0.43
324 0.37
325 0.35
326 0.35
327 0.29
328 0.28
329 0.3
330 0.37
331 0.44
332 0.53
333 0.58
334 0.63
335 0.68
336 0.74
337 0.74
338 0.7
339 0.62
340 0.54
341 0.46
342 0.38
343 0.31
344 0.19
345 0.15
346 0.08
347 0.05
348 0.03
349 0.03
350 0.04
351 0.04
352 0.06
353 0.1
354 0.17
355 0.27
356 0.37
357 0.48
358 0.58
359 0.66
360 0.74
361 0.78
362 0.78
363 0.78
364 0.75
365 0.67
366 0.59
367 0.57
368 0.48
369 0.4
370 0.34
371 0.27
372 0.21
373 0.19
374 0.22
375 0.28
376 0.36
377 0.46
378 0.54
379 0.62
380 0.71
381 0.77
382 0.8
383 0.8
384 0.77
385 0.71
386 0.7
387 0.63
388 0.55
389 0.49
390 0.43
391 0.4
392 0.4
393 0.39
394 0.36
395 0.39
396 0.45
397 0.49
398 0.5
399 0.49
400 0.51
401 0.51
402 0.51
403 0.46
404 0.41
405 0.37
406 0.34
407 0.27
408 0.18
409 0.16
410 0.12
411 0.15
412 0.18
413 0.22
414 0.28
415 0.35
416 0.43
417 0.53
418 0.54
419 0.56
420 0.59
421 0.64
422 0.65
423 0.64
424 0.66
425 0.57
426 0.56
427 0.54
428 0.49
429 0.47
430 0.51
431 0.55
432 0.56
433 0.64
434 0.7
435 0.77
436 0.81
437 0.84
438 0.83
439 0.82
440 0.75
441 0.7
442 0.63
443 0.55
444 0.47
445 0.4
446 0.35
447 0.34
448 0.36
449 0.38
450 0.46