FuNGI

A0A5B1REP1

Protein Details

Accession

A0A5B1REP1

Localization Confidence

High

Confidence Score

23.2

NoLS Segment(s)

Position	Sequence	Protein Nature
110-129	ASRLRRPTRRPHDARAIPRP	Basic
155-175	VTTPPPPSRQRPRRSRDAPST	Hydrophilic
382-401	LTTLPPSIRHPRRPHNAPAA	Hydrophilic
436-458	FTTPPAPSSQRPRRLRNAPGALV	Hydrophilic

NLS Segment(s)

Position	Sequence
112-148	RLRRPTRRPHDARAIPRPCPLRHPSPMPPAPPSSRRR
160-168	PPSRQRPRR
446-470	RPRRLRNAPGALVTPVPSRRRPPRR

Subcellular Location(s)

nucl 23.5, cyto_nucl 14.5

Family & Domain DBs

Amino Acid Sequences

MEVDEEGKTTEGKPTGKDSATAPTTGDGAAPPPASSSDASTLPQAAKPAPALDEAEPQNIPLPPVHGQAFAKAVHGVSKRSSITPYRALYTVPPLCAPARPLEPHAASAASRLRRPTRRPHDARAIPRPCPLRHPSPMPPAPPSSRRRIDAAPAVTTPPPPSRQRPRRSRDAPSTLMTPAPSPRRPRVVDDATGAVFTTPAAPSQRPRRPCDAPAVTTPPPPLRRSRRQYDTPAAHTTPSPPTRRPRGVDDTPGALVTPAPSPRRPCGVDDAARAVFTTPAAPSQCPRCPCDARAVTTPPPPPTRRPRSVDDAARAVFMTPPAPSQRPRRPCDALAVTTPPPPSRRRPRGVDDAPGALVGALVTPPPSSRRPRRPCDAPAALTTLPPSIRHPRRPHNAPAAHTTPSPPTRRPRGVDDTPGALMTPAPSPRRPRAVFTTPPAPSSQRPRRLRNAPGALVTPVPSRRRPPRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.32
2	0.38
3	0.38
4	0.38
5	0.34
6	0.38
7	0.37
8	0.35
9	0.29
10	0.23
11	0.23
12	0.21
13	0.2
14	0.11
15	0.11
16	0.14
17	0.13
18	0.12
19	0.13
20	0.14
21	0.16
22	0.16
23	0.18
24	0.18
25	0.19
26	0.2
27	0.2
28	0.22
29	0.21
30	0.22
31	0.21
32	0.18
33	0.19
34	0.19
35	0.19
36	0.18
37	0.19
38	0.2
39	0.19
40	0.26
41	0.25
42	0.27
43	0.25
44	0.24
45	0.26
46	0.23
47	0.23
48	0.16
49	0.18
50	0.17
51	0.21
52	0.22
53	0.23
54	0.22
55	0.24
56	0.26
57	0.22
58	0.21
59	0.18
60	0.17
61	0.2
62	0.22
63	0.22
64	0.21
65	0.27
66	0.27
67	0.28
68	0.33
69	0.31
70	0.35
71	0.41
72	0.41
73	0.38
74	0.36
75	0.36
76	0.33
77	0.37
78	0.34
79	0.27
80	0.25
81	0.25
82	0.25
83	0.26
84	0.25
85	0.21
86	0.23
87	0.24
88	0.27
89	0.31
90	0.31
91	0.31
92	0.3
93	0.26
94	0.21
95	0.23
96	0.26
97	0.22
98	0.24
99	0.29
100	0.36
101	0.44
102	0.5
103	0.57
104	0.61
105	0.69
106	0.74
107	0.76
108	0.78
109	0.78
110	0.8
111	0.8
112	0.75
113	0.66
114	0.65
115	0.63
116	0.53
117	0.53
118	0.5
119	0.48
120	0.48
121	0.53
122	0.54
123	0.58
124	0.62
125	0.57
126	0.54
127	0.51
128	0.51
129	0.52
130	0.5
131	0.49
132	0.5
133	0.49
134	0.5
135	0.47
136	0.47
137	0.46
138	0.43
139	0.36
140	0.32
141	0.32
142	0.29
143	0.27
144	0.25
145	0.21
146	0.24
147	0.26
148	0.35
149	0.44
150	0.54
151	0.63
152	0.71
153	0.74
154	0.79
155	0.81
156	0.81
157	0.79
158	0.76
159	0.7
160	0.61
161	0.56
162	0.46
163	0.4
164	0.32
165	0.23
166	0.21
167	0.24
168	0.27
169	0.31
170	0.35
171	0.41
172	0.43
173	0.47
174	0.5
175	0.48
176	0.45
177	0.41
178	0.38
179	0.3
180	0.28
181	0.23
182	0.14
183	0.09
184	0.07
185	0.06
186	0.05
187	0.06
188	0.09
189	0.1
190	0.15
191	0.26
192	0.32
193	0.37
194	0.42
195	0.47
196	0.49
197	0.5
198	0.55
199	0.49
200	0.45
201	0.43
202	0.45
203	0.39
204	0.36
205	0.35
206	0.31
207	0.3
208	0.3
209	0.35
210	0.38
211	0.47
212	0.53
213	0.6
214	0.61
215	0.64
216	0.69
217	0.69
218	0.65
219	0.59
220	0.56
221	0.48
222	0.41
223	0.35
224	0.3
225	0.28
226	0.29
227	0.28
228	0.29
229	0.35
230	0.43
231	0.48
232	0.48
233	0.49
234	0.51
235	0.51
236	0.51
237	0.46
238	0.39
239	0.34
240	0.31
241	0.24
242	0.15
243	0.12
244	0.08
245	0.09
246	0.11
247	0.13
248	0.16
249	0.19
250	0.22
251	0.27
252	0.27
253	0.27
254	0.31
255	0.34
256	0.35
257	0.33
258	0.35
259	0.3
260	0.28
261	0.26
262	0.19
263	0.13
264	0.1
265	0.1
266	0.06
267	0.09
268	0.1
269	0.11
270	0.13
271	0.19
272	0.23
273	0.25
274	0.27
275	0.32
276	0.34
277	0.34
278	0.42
279	0.4
280	0.39
281	0.41
282	0.44
283	0.4
284	0.42
285	0.44
286	0.39
287	0.42
288	0.41
289	0.45
290	0.51
291	0.57
292	0.59
293	0.61
294	0.62
295	0.64
296	0.68
297	0.66
298	0.59
299	0.54
300	0.46
301	0.41
302	0.35
303	0.27
304	0.2
305	0.15
306	0.11
307	0.08
308	0.1
309	0.14
310	0.17
311	0.22
312	0.31
313	0.41
314	0.49
315	0.53
316	0.58
317	0.59
318	0.57
319	0.61
320	0.57
321	0.49
322	0.43
323	0.43
324	0.37
325	0.35
326	0.35
327	0.29
328	0.28
329	0.3
330	0.37
331	0.44
332	0.53
333	0.58
334	0.63
335	0.68
336	0.74
337	0.74
338	0.7
339	0.62
340	0.54
341	0.46
342	0.38
343	0.31
344	0.19
345	0.15
346	0.08
347	0.05
348	0.03
349	0.03
350	0.04
351	0.04
352	0.06
353	0.1
354	0.17
355	0.27
356	0.37
357	0.48
358	0.58
359	0.66
360	0.74
361	0.78
362	0.78
363	0.78
364	0.75
365	0.67
366	0.59
367	0.57
368	0.48
369	0.4
370	0.34
371	0.27
372	0.21
373	0.19
374	0.22
375	0.28
376	0.36
377	0.46
378	0.54
379	0.62
380	0.71
381	0.77
382	0.8
383	0.8
384	0.77
385	0.71
386	0.7
387	0.63
388	0.55
389	0.49
390	0.43
391	0.4
392	0.4
393	0.39
394	0.36
395	0.39
396	0.45
397	0.49
398	0.5
399	0.49
400	0.51
401	0.51
402	0.51
403	0.46
404	0.41
405	0.37
406	0.34
407	0.27
408	0.18
409	0.16
410	0.12
411	0.15
412	0.18
413	0.22
414	0.28
415	0.35
416	0.43
417	0.53
418	0.54
419	0.56
420	0.59
421	0.64
422	0.65
423	0.64
424	0.66
425	0.57
426	0.56
427	0.54
428	0.49
429	0.47
430	0.51
431	0.55
432	0.56
433	0.64
434	0.7
435	0.77
436	0.81
437	0.84
438	0.83
439	0.82
440	0.75
441	0.7
442	0.63
443	0.55
444	0.47
445	0.4
446	0.35
447	0.34
448	0.36
449	0.38
450	0.46

A0A5B1REP1

3D AlphaFold-predicted Structure Viewer