Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1RBP0

Protein Details
Accession A0A5B1RBP0    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
85-104VTPPHRPRLRRRLAPPSRCHBasic
221-247RASPARRPRAPMRPLRHPRDVPRHPCPBasic
NLS Segment(s)
PositionSequence
90-96RPRLRRR
223-239SPARRPRAPMRPLRHPR
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MPSCAPSHPRDTFVHPQPPSRRPYAPVRPSRSSKALIPEMPLPPHDDLAPPRGLATPRADLVCCPRTPPRDALPTAPRHPRDTHVTPPHRPRLRRRLAPPSRCHAPVPLRRLASPLPACAGPATPPRCPMPPPRHPCDAFVCRPVPPRPAPPLCRDAPVPSRRPRDAPAPPSQHPCDAVPMPARNLRDRARPPAIAMPRAAHATPSRRPCATPLTPSWGSRASPARRPRAPMRPLRHPRDVPRHPCPALAPPLRRPCGTAPPSRRGPAPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.54
3 0.61
4 0.65
5 0.68
6 0.66
7 0.63
8 0.58
9 0.53
10 0.62
11 0.64
12 0.65
13 0.68
14 0.71
15 0.73
16 0.75
17 0.77
18 0.72
19 0.64
20 0.58
21 0.57
22 0.55
23 0.49
24 0.46
25 0.45
26 0.43
27 0.41
28 0.37
29 0.33
30 0.27
31 0.27
32 0.24
33 0.22
34 0.21
35 0.24
36 0.24
37 0.2
38 0.2
39 0.22
40 0.23
41 0.22
42 0.24
43 0.22
44 0.23
45 0.24
46 0.24
47 0.22
48 0.28
49 0.3
50 0.26
51 0.27
52 0.31
53 0.35
54 0.39
55 0.42
56 0.41
57 0.43
58 0.45
59 0.48
60 0.49
61 0.52
62 0.54
63 0.57
64 0.53
65 0.5
66 0.5
67 0.48
68 0.48
69 0.47
70 0.51
71 0.53
72 0.57
73 0.6
74 0.66
75 0.72
76 0.7
77 0.71
78 0.71
79 0.72
80 0.75
81 0.76
82 0.75
83 0.77
84 0.8
85 0.83
86 0.79
87 0.74
88 0.69
89 0.62
90 0.55
91 0.5
92 0.49
93 0.47
94 0.47
95 0.46
96 0.42
97 0.41
98 0.43
99 0.37
100 0.36
101 0.3
102 0.24
103 0.2
104 0.19
105 0.19
106 0.16
107 0.16
108 0.1
109 0.16
110 0.19
111 0.18
112 0.2
113 0.22
114 0.23
115 0.25
116 0.32
117 0.34
118 0.41
119 0.47
120 0.5
121 0.55
122 0.55
123 0.55
124 0.53
125 0.5
126 0.42
127 0.39
128 0.36
129 0.31
130 0.35
131 0.35
132 0.33
133 0.29
134 0.32
135 0.36
136 0.41
137 0.43
138 0.42
139 0.46
140 0.41
141 0.41
142 0.37
143 0.34
144 0.36
145 0.39
146 0.42
147 0.44
148 0.49
149 0.49
150 0.51
151 0.49
152 0.49
153 0.51
154 0.49
155 0.51
156 0.51
157 0.52
158 0.56
159 0.55
160 0.48
161 0.41
162 0.36
163 0.31
164 0.25
165 0.26
166 0.24
167 0.23
168 0.25
169 0.27
170 0.28
171 0.27
172 0.32
173 0.32
174 0.36
175 0.39
176 0.44
177 0.46
178 0.44
179 0.44
180 0.47
181 0.48
182 0.41
183 0.38
184 0.31
185 0.27
186 0.29
187 0.26
188 0.2
189 0.21
190 0.25
191 0.31
192 0.36
193 0.39
194 0.38
195 0.39
196 0.4
197 0.44
198 0.43
199 0.42
200 0.38
201 0.43
202 0.44
203 0.44
204 0.44
205 0.38
206 0.34
207 0.33
208 0.39
209 0.36
210 0.42
211 0.5
212 0.56
213 0.57
214 0.63
215 0.66
216 0.68
217 0.72
218 0.73
219 0.72
220 0.74
221 0.8
222 0.81
223 0.82
224 0.79
225 0.8
226 0.81
227 0.83
228 0.81
229 0.78
230 0.79
231 0.7
232 0.65
233 0.59
234 0.55
235 0.55
236 0.55
237 0.53
238 0.54
239 0.63
240 0.65
241 0.62
242 0.58
243 0.54
244 0.56
245 0.57
246 0.58
247 0.55
248 0.6
249 0.67
250 0.66
251 0.64