Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QJ16

Protein Details
Accession A0A5B1QJ16    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
190-215HAQPVPGKRPRGRPKGSKNRVPSKSABasic
NLS Segment(s)
PositionSequence
195-213PGKRPRGRPKGSKNRVPSK
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018482  Znf-C4H2  
Amino Acid Sequences MASAGPSTQSASAPAAPTQVQAQPLVAQGDWTKNLVHLAKTAELKKHALTLQLHTAHILSAHSTLDQKNKTIQDLKEQKNKLESERVRLLKCLREVNEDRDKADILEAQITSECADLRTRIQQITDGEYALAKRDVDALRAELGQPPLPSLQATLEEKSQQYLQERRLGADAGAGAGFKRGADETGTGEHAQPVPGKRPRGRPKGSKNRVPSKSAAGTSASAPAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.19
5 0.2
6 0.2
7 0.19
8 0.17
9 0.18
10 0.16
11 0.18
12 0.19
13 0.16
14 0.15
15 0.15
16 0.19
17 0.19
18 0.19
19 0.17
20 0.16
21 0.21
22 0.21
23 0.2
24 0.19
25 0.2
26 0.24
27 0.29
28 0.32
29 0.32
30 0.33
31 0.34
32 0.32
33 0.34
34 0.3
35 0.31
36 0.29
37 0.29
38 0.34
39 0.34
40 0.33
41 0.29
42 0.27
43 0.21
44 0.19
45 0.16
46 0.09
47 0.07
48 0.08
49 0.08
50 0.1
51 0.13
52 0.19
53 0.2
54 0.21
55 0.26
56 0.27
57 0.31
58 0.35
59 0.34
60 0.37
61 0.46
62 0.51
63 0.54
64 0.54
65 0.52
66 0.52
67 0.53
68 0.45
69 0.46
70 0.41
71 0.39
72 0.46
73 0.48
74 0.42
75 0.44
76 0.43
77 0.38
78 0.4
79 0.38
80 0.31
81 0.35
82 0.37
83 0.41
84 0.47
85 0.42
86 0.39
87 0.35
88 0.33
89 0.25
90 0.23
91 0.17
92 0.09
93 0.1
94 0.09
95 0.09
96 0.09
97 0.08
98 0.08
99 0.07
100 0.06
101 0.05
102 0.06
103 0.06
104 0.08
105 0.12
106 0.13
107 0.13
108 0.14
109 0.16
110 0.17
111 0.21
112 0.2
113 0.16
114 0.14
115 0.14
116 0.14
117 0.12
118 0.11
119 0.07
120 0.06
121 0.12
122 0.12
123 0.13
124 0.14
125 0.13
126 0.14
127 0.14
128 0.14
129 0.12
130 0.13
131 0.14
132 0.13
133 0.13
134 0.12
135 0.12
136 0.12
137 0.1
138 0.09
139 0.12
140 0.14
141 0.14
142 0.15
143 0.17
144 0.17
145 0.18
146 0.18
147 0.17
148 0.21
149 0.25
150 0.28
151 0.33
152 0.33
153 0.33
154 0.33
155 0.3
156 0.24
157 0.2
158 0.16
159 0.1
160 0.09
161 0.08
162 0.06
163 0.07
164 0.07
165 0.05
166 0.06
167 0.06
168 0.07
169 0.09
170 0.1
171 0.12
172 0.14
173 0.17
174 0.16
175 0.16
176 0.17
177 0.16
178 0.17
179 0.19
180 0.2
181 0.27
182 0.33
183 0.41
184 0.46
185 0.56
186 0.65
187 0.71
188 0.77
189 0.79
190 0.84
191 0.87
192 0.91
193 0.89
194 0.89
195 0.89
196 0.85
197 0.8
198 0.72
199 0.69
200 0.66
201 0.58
202 0.5
203 0.42
204 0.38
205 0.33
206 0.34
207 0.25