Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QAA3

Protein Details
Accession A0A5B1QAA3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-99MELLRNSKDKKARKLTKKRLGTLLRSHydrophilic
NLS Segment(s)
PositionSequence
80-102SKDKKARKLTKKRLGTLLRSKRK
Subcellular Location(s) nucl 20, mito_nucl 13.499, cyto_nucl 12.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MVRNSEYPSFREEKSVEVCDADLRRGLAHGHPTTPIAKGVRPSHRKGIRSTKTTFVRSVVREVVGFSPYERRVMELLRNSKDKKARKLTKKRLGTLLRSKRKLEELSTIIQESRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.31
4 0.28
5 0.28
6 0.27
7 0.27
8 0.23
9 0.19
10 0.16
11 0.15
12 0.16
13 0.17
14 0.15
15 0.22
16 0.22
17 0.21
18 0.21
19 0.23
20 0.23
21 0.22
22 0.23
23 0.16
24 0.16
25 0.22
26 0.28
27 0.36
28 0.41
29 0.44
30 0.51
31 0.55
32 0.57
33 0.57
34 0.61
35 0.58
36 0.58
37 0.57
38 0.55
39 0.54
40 0.54
41 0.48
42 0.4
43 0.37
44 0.33
45 0.33
46 0.26
47 0.21
48 0.18
49 0.18
50 0.17
51 0.13
52 0.11
53 0.09
54 0.14
55 0.14
56 0.16
57 0.14
58 0.15
59 0.16
60 0.18
61 0.23
62 0.25
63 0.31
64 0.33
65 0.4
66 0.4
67 0.45
68 0.52
69 0.54
70 0.56
71 0.61
72 0.67
73 0.72
74 0.82
75 0.87
76 0.89
77 0.9
78 0.85
79 0.84
80 0.8
81 0.78
82 0.78
83 0.78
84 0.78
85 0.74
86 0.72
87 0.66
88 0.67
89 0.62
90 0.55
91 0.53
92 0.46
93 0.46
94 0.47
95 0.44
96 0.37