Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1RDW4

Protein Details
Accession A0A5B1RDW4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
392-421ALRAVRRPVRRPPGVRRPPRRPLCHSRALCHydrophilic
NLS Segment(s)
PositionSequence
396-412VRRPVRRPPGVRRPPRR
Subcellular Location(s) nucl 9, cyto 7, extr 6, mito 4
Family & Domain DBs
Amino Acid Sequences MTWELESFGNSRTLFISAVAPPSLMCQRVPPPSPPSPTHHRPLTPRCRLCASAAALARPLPPLLTHCRLSAPQRIPLPSSCAHSRLLVPQHAPPPPPRRPRSPTAAIDTLNTASSHPTRPPRALYALRALPAALAALVRPMPPSFAQCRPCSPTAALVRPPPPSTPSTPPPRALHAPSAAIDAAPTRCTCPLRALRALRALPAALPALVRPPPPSTPCPRRRRAVRTVDAASSRPMCPPWVVCALPAPSAALSALPTPCPPFLRPVRPPYALSALPTPSDAVNAPSRPSTLPPRAVHTLDVLHAPWMHPPPPLTRCLPPSTRCLPLHVPFTRPPPPYVLSAPSVHCLCLHPPSAPFNCPLVRPPRHLRHPPALRCPVHRPPPYVLSAALCAALRAVRRPVRRPPGVRRPPRRPLCHSRALCAVCPLSTRRPCPLCRPLPPCAPLPTPFAHPVRRLPALCALQPPSAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.16
5 0.2
6 0.19
7 0.17
8 0.16
9 0.2
10 0.23
11 0.2
12 0.19
13 0.21
14 0.28
15 0.36
16 0.4
17 0.42
18 0.46
19 0.52
20 0.58
21 0.57
22 0.57
23 0.59
24 0.62
25 0.64
26 0.63
27 0.62
28 0.65
29 0.72
30 0.76
31 0.77
32 0.75
33 0.71
34 0.7
35 0.66
36 0.6
37 0.56
38 0.49
39 0.45
40 0.42
41 0.39
42 0.34
43 0.33
44 0.3
45 0.23
46 0.19
47 0.13
48 0.12
49 0.16
50 0.23
51 0.27
52 0.28
53 0.28
54 0.31
55 0.35
56 0.38
57 0.43
58 0.39
59 0.41
60 0.44
61 0.46
62 0.45
63 0.43
64 0.44
65 0.37
66 0.39
67 0.35
68 0.32
69 0.31
70 0.3
71 0.3
72 0.32
73 0.35
74 0.34
75 0.33
76 0.36
77 0.41
78 0.43
79 0.43
80 0.44
81 0.47
82 0.53
83 0.61
84 0.61
85 0.65
86 0.68
87 0.73
88 0.73
89 0.72
90 0.68
91 0.65
92 0.64
93 0.55
94 0.49
95 0.44
96 0.36
97 0.28
98 0.22
99 0.15
100 0.14
101 0.16
102 0.18
103 0.22
104 0.29
105 0.32
106 0.35
107 0.39
108 0.39
109 0.44
110 0.45
111 0.43
112 0.42
113 0.4
114 0.37
115 0.34
116 0.29
117 0.21
118 0.18
119 0.14
120 0.07
121 0.04
122 0.04
123 0.05
124 0.06
125 0.06
126 0.07
127 0.07
128 0.09
129 0.1
130 0.15
131 0.19
132 0.26
133 0.31
134 0.32
135 0.37
136 0.4
137 0.41
138 0.39
139 0.35
140 0.35
141 0.36
142 0.39
143 0.37
144 0.36
145 0.38
146 0.38
147 0.38
148 0.32
149 0.29
150 0.29
151 0.31
152 0.32
153 0.36
154 0.43
155 0.45
156 0.49
157 0.48
158 0.49
159 0.48
160 0.45
161 0.42
162 0.34
163 0.32
164 0.27
165 0.26
166 0.21
167 0.16
168 0.13
169 0.1
170 0.09
171 0.09
172 0.09
173 0.09
174 0.12
175 0.13
176 0.14
177 0.2
178 0.26
179 0.31
180 0.38
181 0.39
182 0.39
183 0.45
184 0.44
185 0.37
186 0.31
187 0.25
188 0.18
189 0.17
190 0.13
191 0.07
192 0.07
193 0.06
194 0.08
195 0.09
196 0.1
197 0.1
198 0.13
199 0.16
200 0.2
201 0.24
202 0.31
203 0.4
204 0.5
205 0.57
206 0.6
207 0.65
208 0.7
209 0.74
210 0.75
211 0.74
212 0.7
213 0.66
214 0.63
215 0.57
216 0.5
217 0.42
218 0.34
219 0.26
220 0.21
221 0.16
222 0.14
223 0.12
224 0.12
225 0.12
226 0.13
227 0.15
228 0.14
229 0.14
230 0.16
231 0.16
232 0.16
233 0.15
234 0.12
235 0.08
236 0.09
237 0.08
238 0.05
239 0.05
240 0.06
241 0.06
242 0.07
243 0.07
244 0.09
245 0.1
246 0.12
247 0.12
248 0.17
249 0.23
250 0.31
251 0.36
252 0.41
253 0.46
254 0.47
255 0.47
256 0.43
257 0.42
258 0.33
259 0.29
260 0.25
261 0.2
262 0.18
263 0.17
264 0.15
265 0.1
266 0.11
267 0.1
268 0.1
269 0.13
270 0.13
271 0.14
272 0.14
273 0.15
274 0.15
275 0.18
276 0.23
277 0.25
278 0.33
279 0.33
280 0.38
281 0.4
282 0.4
283 0.38
284 0.32
285 0.27
286 0.2
287 0.2
288 0.14
289 0.12
290 0.11
291 0.11
292 0.13
293 0.14
294 0.14
295 0.15
296 0.16
297 0.22
298 0.24
299 0.28
300 0.28
301 0.29
302 0.33
303 0.37
304 0.42
305 0.38
306 0.42
307 0.42
308 0.47
309 0.43
310 0.44
311 0.44
312 0.42
313 0.48
314 0.43
315 0.44
316 0.39
317 0.45
318 0.48
319 0.44
320 0.41
321 0.37
322 0.37
323 0.36
324 0.36
325 0.33
326 0.28
327 0.29
328 0.29
329 0.28
330 0.26
331 0.23
332 0.21
333 0.19
334 0.18
335 0.2
336 0.2
337 0.18
338 0.2
339 0.26
340 0.29
341 0.29
342 0.29
343 0.28
344 0.28
345 0.28
346 0.32
347 0.35
348 0.37
349 0.42
350 0.5
351 0.56
352 0.64
353 0.71
354 0.73
355 0.74
356 0.79
357 0.79
358 0.79
359 0.79
360 0.73
361 0.7
362 0.71
363 0.7
364 0.7
365 0.68
366 0.62
367 0.58
368 0.6
369 0.57
370 0.5
371 0.42
372 0.33
373 0.29
374 0.25
375 0.21
376 0.15
377 0.12
378 0.11
379 0.12
380 0.12
381 0.14
382 0.22
383 0.28
384 0.35
385 0.42
386 0.52
387 0.6
388 0.68
389 0.73
390 0.75
391 0.8
392 0.84
393 0.88
394 0.88
395 0.88
396 0.89
397 0.91
398 0.89
399 0.87
400 0.87
401 0.85
402 0.85
403 0.77
404 0.7
405 0.69
406 0.63
407 0.56
408 0.5
409 0.43
410 0.33
411 0.34
412 0.35
413 0.36
414 0.4
415 0.43
416 0.47
417 0.53
418 0.57
419 0.63
420 0.69
421 0.68
422 0.7
423 0.72
424 0.7
425 0.72
426 0.71
427 0.66
428 0.62
429 0.57
430 0.5
431 0.49
432 0.44
433 0.41
434 0.45
435 0.46
436 0.46
437 0.46
438 0.51
439 0.53
440 0.58
441 0.53
442 0.49
443 0.53
444 0.51
445 0.49
446 0.48
447 0.46
448 0.4