Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1R723

Protein Details
Accession A0A5B1R723    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-30HLAVHRRRFTRPSRPRHPLVLLHydrophilic
63-84RAPPRAPPSRARHCRRLPLVRAHydrophilic
NLS Segment(s)
PositionSequence
63-78RAPPRAPPSRARHCRR
164-169TRRRRA
178-195APSPRRRRALVASRRRAR
Subcellular Location(s) mito 21, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MSLASTRRHLAVHRRRFTRPSRPRHPLVLLLAPRHSSRPASLALLLAPSPLLRAASRGTPSSRAPPRAPPSRARHCRRLPLVRAVPRASASSARRFSRPAFFSRPALLSRSSSGPRPRASQSRGALVPACRSALALFTPSPRLRLVVAPVSPHASSRPTSSRPTRRRRAVVSSRPCVAPSPRRRRALVASRRRARASSLRLVALASSSHCPRALASPCRVGCRVRAARRRAFSRLSVAPTCLADAPFASCLRVGASRLRACVSRRRAVLALFSPVTPLPPRARARSLYLLARPLPSRCLSSSRRCGVLVRFSRLRCTLAPVLGLHNNVYVTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.75
4 0.78
5 0.79
6 0.78
7 0.78
8 0.79
9 0.82
10 0.81
11 0.8
12 0.76
13 0.71
14 0.66
15 0.64
16 0.58
17 0.52
18 0.49
19 0.44
20 0.41
21 0.37
22 0.34
23 0.27
24 0.25
25 0.25
26 0.25
27 0.25
28 0.24
29 0.22
30 0.2
31 0.19
32 0.17
33 0.13
34 0.11
35 0.08
36 0.08
37 0.08
38 0.09
39 0.07
40 0.09
41 0.11
42 0.17
43 0.19
44 0.22
45 0.24
46 0.27
47 0.3
48 0.37
49 0.43
50 0.44
51 0.44
52 0.5
53 0.56
54 0.62
55 0.64
56 0.64
57 0.66
58 0.71
59 0.78
60 0.77
61 0.79
62 0.76
63 0.81
64 0.81
65 0.82
66 0.76
67 0.76
68 0.78
69 0.74
70 0.73
71 0.65
72 0.57
73 0.48
74 0.44
75 0.35
76 0.33
77 0.3
78 0.33
79 0.37
80 0.37
81 0.38
82 0.39
83 0.4
84 0.42
85 0.42
86 0.39
87 0.41
88 0.42
89 0.43
90 0.43
91 0.42
92 0.35
93 0.34
94 0.29
95 0.23
96 0.22
97 0.24
98 0.23
99 0.26
100 0.31
101 0.34
102 0.34
103 0.37
104 0.4
105 0.43
106 0.46
107 0.49
108 0.44
109 0.44
110 0.42
111 0.39
112 0.36
113 0.29
114 0.28
115 0.2
116 0.19
117 0.13
118 0.13
119 0.12
120 0.1
121 0.09
122 0.09
123 0.09
124 0.09
125 0.15
126 0.15
127 0.17
128 0.16
129 0.16
130 0.16
131 0.17
132 0.18
133 0.17
134 0.17
135 0.17
136 0.17
137 0.19
138 0.17
139 0.16
140 0.14
141 0.12
142 0.12
143 0.15
144 0.19
145 0.2
146 0.26
147 0.35
148 0.44
149 0.52
150 0.62
151 0.67
152 0.69
153 0.72
154 0.7
155 0.71
156 0.71
157 0.71
158 0.7
159 0.64
160 0.58
161 0.53
162 0.49
163 0.41
164 0.36
165 0.36
166 0.39
167 0.46
168 0.52
169 0.56
170 0.57
171 0.58
172 0.62
173 0.62
174 0.62
175 0.62
176 0.64
177 0.67
178 0.69
179 0.66
180 0.58
181 0.53
182 0.51
183 0.46
184 0.44
185 0.39
186 0.36
187 0.35
188 0.34
189 0.29
190 0.21
191 0.15
192 0.09
193 0.1
194 0.1
195 0.11
196 0.11
197 0.12
198 0.12
199 0.19
200 0.24
201 0.27
202 0.29
203 0.36
204 0.38
205 0.41
206 0.42
207 0.36
208 0.31
209 0.36
210 0.42
211 0.44
212 0.52
213 0.56
214 0.62
215 0.68
216 0.7
217 0.65
218 0.59
219 0.52
220 0.5
221 0.47
222 0.45
223 0.4
224 0.36
225 0.32
226 0.28
227 0.27
228 0.21
229 0.17
230 0.11
231 0.1
232 0.11
233 0.12
234 0.12
235 0.11
236 0.1
237 0.1
238 0.11
239 0.12
240 0.13
241 0.16
242 0.24
243 0.26
244 0.27
245 0.29
246 0.31
247 0.33
248 0.41
249 0.43
250 0.42
251 0.41
252 0.44
253 0.44
254 0.42
255 0.45
256 0.37
257 0.35
258 0.29
259 0.27
260 0.25
261 0.23
262 0.24
263 0.2
264 0.22
265 0.21
266 0.29
267 0.34
268 0.39
269 0.44
270 0.45
271 0.5
272 0.53
273 0.53
274 0.5
275 0.49
276 0.47
277 0.44
278 0.45
279 0.41
280 0.34
281 0.35
282 0.31
283 0.32
284 0.29
285 0.36
286 0.39
287 0.47
288 0.55
289 0.54
290 0.55
291 0.52
292 0.54
293 0.52
294 0.56
295 0.53
296 0.51
297 0.54
298 0.52
299 0.58
300 0.56
301 0.53
302 0.44
303 0.44
304 0.41
305 0.36
306 0.38
307 0.32
308 0.35
309 0.35
310 0.35
311 0.28
312 0.24