Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V1F6

Protein Details
Accession H1V1F6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
91-113QVSQPLTRYRRGRRGRSRHRQPGBasic
NLS Segment(s)
PositionSequence
100-113RRGRRGRSRHRQPG
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MISRGIYIQSQTKNTRYRIGRPGPPSRHRKLHVKVFGPSGPSILCTAEVVFTPCPGHAGPSHRGPACRQLQQRPGPVRHGQFAATTFLLYQVSQPLTRYRRGRRGRSRHRQPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.55
3 0.53
4 0.56
5 0.59
6 0.63
7 0.63
8 0.64
9 0.72
10 0.72
11 0.76
12 0.77
13 0.74
14 0.75
15 0.72
16 0.74
17 0.72
18 0.73
19 0.72
20 0.67
21 0.62
22 0.58
23 0.54
24 0.47
25 0.39
26 0.29
27 0.21
28 0.18
29 0.16
30 0.11
31 0.1
32 0.07
33 0.07
34 0.07
35 0.07
36 0.08
37 0.07
38 0.08
39 0.08
40 0.07
41 0.09
42 0.08
43 0.09
44 0.1
45 0.14
46 0.17
47 0.2
48 0.25
49 0.24
50 0.26
51 0.26
52 0.32
53 0.32
54 0.37
55 0.38
56 0.41
57 0.49
58 0.54
59 0.61
60 0.59
61 0.57
62 0.56
63 0.57
64 0.52
65 0.46
66 0.41
67 0.34
68 0.28
69 0.27
70 0.24
71 0.18
72 0.16
73 0.13
74 0.13
75 0.13
76 0.11
77 0.1
78 0.11
79 0.14
80 0.14
81 0.16
82 0.24
83 0.27
84 0.35
85 0.43
86 0.48
87 0.57
88 0.66
89 0.76
90 0.78
91 0.86
92 0.89
93 0.92