Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QQ83

Protein Details
Accession A0A5B1QQ83    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
354-388YRDDRRAERRADRAQRRAERRARKAARRAVWHNDGBasic
NLS Segment(s)
PositionSequence
350-381EKRAYRDDRRAERRADRAQRRAERRARKAARR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR028018  DUF4646  
Pfam View protein in Pfam  
PF15496  DUF4646  
Amino Acid Sequences MPEAPPAYAPPPGPPPQASNSNQPGGYTDEKGQGSSRGLADAYYAPPPDSPHASGSSPYPAGSSSQSPPQGFYPSPSGFSQGGSPNPDDANAGQQFPGFTYAGKPPAKRDPLNPPPASFSRQPDPQCAYPRLREPVRIPAQDKKTLDKGFIPIFPAPQLLMAHDVQPADVSRLLEDCHLMSAPSMGQKISANVASLAMSIGALPGLRITRTLAGLVKRGNVDDVAGLLEVWDEAFFGPRKLRLTMQRGRNNDDDSSSSSSSDSDSEGHHKHRRSHSGADAYNGKARPGSTGLGGGRIVVGGSSLGMRAEFGRGFGGGGRPGPVGGLGGGLGVIAGAIGSRMSMREERIAEKRAYRDDRRAERRADRAQRRAERRARKAARRAVWHNDGVSGSVDERIYLVISNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.41
4 0.5
5 0.49
6 0.51
7 0.52
8 0.52
9 0.5
10 0.45
11 0.41
12 0.38
13 0.38
14 0.32
15 0.28
16 0.31
17 0.31
18 0.32
19 0.31
20 0.29
21 0.28
22 0.28
23 0.26
24 0.2
25 0.2
26 0.19
27 0.19
28 0.18
29 0.18
30 0.17
31 0.17
32 0.16
33 0.17
34 0.21
35 0.23
36 0.25
37 0.25
38 0.25
39 0.28
40 0.28
41 0.28
42 0.28
43 0.29
44 0.24
45 0.22
46 0.19
47 0.16
48 0.17
49 0.19
50 0.21
51 0.19
52 0.25
53 0.31
54 0.3
55 0.32
56 0.32
57 0.34
58 0.3
59 0.31
60 0.32
61 0.27
62 0.3
63 0.28
64 0.3
65 0.26
66 0.26
67 0.27
68 0.23
69 0.25
70 0.26
71 0.26
72 0.24
73 0.24
74 0.23
75 0.2
76 0.17
77 0.21
78 0.19
79 0.19
80 0.17
81 0.17
82 0.17
83 0.16
84 0.19
85 0.11
86 0.1
87 0.13
88 0.16
89 0.24
90 0.27
91 0.28
92 0.3
93 0.39
94 0.46
95 0.46
96 0.48
97 0.5
98 0.56
99 0.65
100 0.62
101 0.53
102 0.52
103 0.52
104 0.52
105 0.45
106 0.4
107 0.36
108 0.42
109 0.42
110 0.43
111 0.45
112 0.46
113 0.49
114 0.49
115 0.47
116 0.45
117 0.48
118 0.5
119 0.46
120 0.46
121 0.42
122 0.47
123 0.5
124 0.51
125 0.48
126 0.49
127 0.53
128 0.54
129 0.53
130 0.47
131 0.47
132 0.44
133 0.42
134 0.36
135 0.34
136 0.3
137 0.29
138 0.28
139 0.21
140 0.2
141 0.19
142 0.17
143 0.13
144 0.13
145 0.12
146 0.09
147 0.11
148 0.11
149 0.11
150 0.12
151 0.12
152 0.1
153 0.1
154 0.1
155 0.08
156 0.1
157 0.09
158 0.08
159 0.09
160 0.09
161 0.09
162 0.09
163 0.08
164 0.07
165 0.07
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.08
172 0.07
173 0.08
174 0.08
175 0.09
176 0.1
177 0.1
178 0.08
179 0.08
180 0.08
181 0.07
182 0.07
183 0.06
184 0.04
185 0.04
186 0.03
187 0.03
188 0.03
189 0.02
190 0.02
191 0.03
192 0.04
193 0.04
194 0.04
195 0.05
196 0.07
197 0.07
198 0.09
199 0.1
200 0.11
201 0.14
202 0.15
203 0.16
204 0.15
205 0.15
206 0.14
207 0.11
208 0.1
209 0.08
210 0.07
211 0.06
212 0.05
213 0.05
214 0.04
215 0.04
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.06
222 0.06
223 0.07
224 0.09
225 0.12
226 0.14
227 0.15
228 0.2
229 0.26
230 0.34
231 0.41
232 0.49
233 0.54
234 0.56
235 0.59
236 0.58
237 0.53
238 0.45
239 0.39
240 0.31
241 0.28
242 0.3
243 0.25
244 0.21
245 0.19
246 0.18
247 0.17
248 0.16
249 0.13
250 0.09
251 0.1
252 0.15
253 0.18
254 0.25
255 0.3
256 0.34
257 0.41
258 0.49
259 0.56
260 0.56
261 0.59
262 0.59
263 0.61
264 0.57
265 0.53
266 0.48
267 0.41
268 0.41
269 0.35
270 0.28
271 0.21
272 0.21
273 0.2
274 0.19
275 0.18
276 0.13
277 0.17
278 0.17
279 0.18
280 0.18
281 0.15
282 0.12
283 0.11
284 0.1
285 0.05
286 0.05
287 0.03
288 0.03
289 0.04
290 0.04
291 0.04
292 0.04
293 0.05
294 0.05
295 0.08
296 0.08
297 0.08
298 0.09
299 0.09
300 0.09
301 0.1
302 0.12
303 0.11
304 0.11
305 0.12
306 0.12
307 0.12
308 0.11
309 0.1
310 0.08
311 0.07
312 0.06
313 0.04
314 0.04
315 0.04
316 0.04
317 0.03
318 0.02
319 0.02
320 0.02
321 0.02
322 0.02
323 0.02
324 0.02
325 0.02
326 0.03
327 0.04
328 0.08
329 0.11
330 0.13
331 0.19
332 0.22
333 0.28
334 0.34
335 0.38
336 0.39
337 0.42
338 0.45
339 0.49
340 0.55
341 0.56
342 0.6
343 0.65
344 0.72
345 0.76
346 0.77
347 0.75
348 0.75
349 0.77
350 0.78
351 0.79
352 0.78
353 0.78
354 0.82
355 0.84
356 0.84
357 0.86
358 0.85
359 0.85
360 0.85
361 0.87
362 0.86
363 0.86
364 0.88
365 0.88
366 0.86
367 0.85
368 0.83
369 0.81
370 0.78
371 0.72
372 0.62
373 0.55
374 0.47
375 0.39
376 0.33
377 0.25
378 0.19
379 0.18
380 0.17
381 0.14
382 0.14
383 0.13
384 0.12