Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W2L4

Protein Details
Accession H1W2L4   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-84VSRSACHRGHHHQRRRPPRGRGPALGBasic
NLS Segment(s)
PositionSequence
70-81HQRRRPPRGRGP
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences PSFISSSFSRSSSRSRRRTSSHHLISTNPPPCTISCLLTSILFNAYPATASRHHLHHEVSRSACHRGHHHQRRRPPRGRGPALGLPLVPQRRSALRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.67
4 0.71
5 0.77
6 0.77
7 0.77
8 0.75
9 0.71
10 0.65
11 0.6
12 0.6
13 0.6
14 0.56
15 0.45
16 0.37
17 0.33
18 0.32
19 0.34
20 0.29
21 0.22
22 0.17
23 0.19
24 0.19
25 0.18
26 0.18
27 0.13
28 0.12
29 0.09
30 0.08
31 0.07
32 0.06
33 0.06
34 0.06
35 0.08
36 0.09
37 0.12
38 0.14
39 0.16
40 0.18
41 0.2
42 0.22
43 0.23
44 0.26
45 0.27
46 0.26
47 0.28
48 0.28
49 0.3
50 0.3
51 0.29
52 0.3
53 0.36
54 0.46
55 0.54
56 0.62
57 0.66
58 0.75
59 0.83
60 0.88
61 0.88
62 0.86
63 0.86
64 0.87
65 0.86
66 0.8
67 0.76
68 0.7
69 0.64
70 0.55
71 0.44
72 0.35
73 0.36
74 0.37
75 0.3
76 0.27
77 0.27