Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1RBS2

Protein Details
Accession A0A5B1RBS2    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
30-49VDTPCTPSARRRRPLPPSAAHydrophilic
191-216VPSRPSAPRRRPRSPTAARRRPRSTTHydrophilic
NLS Segment(s)
PositionSequence
193-213SRPSAPRRRPRSPTAARRRPR
Subcellular Location(s) nucl 13, extr 6, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MPPSAALYDPLRPLSAPLRAVHAVGVVHAVDTPCTPSARRRRPLPPSAALSTPLRILSAPLRILSAPLRAVRAVDVPSAPSLHPCALSDASARPLCCHTPPSLPPYAPCAPYTPSTRRRLAVCPVAALVRPQPPPCRLFAPQRVPSCPSAPHRRPRWSTATPAASSRPSASHRRPCSSTAAHRRLLAPQHVPSRPSAPRRRPRSPTAARRRPRSTTAAFSRSRSSTAALTHSLTAALTRSSRPWLAFSSPSPPRSPHGRHLPSSPAVVARQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.27
4 0.25
5 0.3
6 0.3
7 0.3
8 0.27
9 0.24
10 0.18
11 0.15
12 0.16
13 0.09
14 0.09
15 0.1
16 0.1
17 0.08
18 0.09
19 0.12
20 0.12
21 0.14
22 0.15
23 0.23
24 0.35
25 0.44
26 0.52
27 0.57
28 0.65
29 0.73
30 0.81
31 0.79
32 0.75
33 0.71
34 0.66
35 0.6
36 0.53
37 0.45
38 0.37
39 0.3
40 0.23
41 0.18
42 0.14
43 0.15
44 0.15
45 0.18
46 0.18
47 0.17
48 0.18
49 0.17
50 0.19
51 0.18
52 0.18
53 0.16
54 0.16
55 0.17
56 0.16
57 0.17
58 0.16
59 0.17
60 0.16
61 0.14
62 0.13
63 0.13
64 0.13
65 0.14
66 0.13
67 0.12
68 0.13
69 0.12
70 0.13
71 0.12
72 0.15
73 0.14
74 0.15
75 0.15
76 0.14
77 0.18
78 0.19
79 0.19
80 0.17
81 0.19
82 0.2
83 0.2
84 0.21
85 0.18
86 0.22
87 0.25
88 0.29
89 0.3
90 0.29
91 0.28
92 0.32
93 0.33
94 0.28
95 0.27
96 0.23
97 0.22
98 0.25
99 0.3
100 0.32
101 0.37
102 0.41
103 0.43
104 0.43
105 0.44
106 0.44
107 0.44
108 0.42
109 0.34
110 0.29
111 0.26
112 0.25
113 0.22
114 0.19
115 0.16
116 0.14
117 0.16
118 0.18
119 0.21
120 0.23
121 0.25
122 0.26
123 0.28
124 0.26
125 0.32
126 0.38
127 0.43
128 0.47
129 0.48
130 0.49
131 0.47
132 0.46
133 0.4
134 0.36
135 0.34
136 0.38
137 0.42
138 0.49
139 0.53
140 0.6
141 0.62
142 0.63
143 0.65
144 0.58
145 0.57
146 0.55
147 0.52
148 0.44
149 0.41
150 0.38
151 0.3
152 0.28
153 0.23
154 0.2
155 0.19
156 0.27
157 0.34
158 0.41
159 0.46
160 0.5
161 0.52
162 0.51
163 0.54
164 0.51
165 0.53
166 0.54
167 0.54
168 0.51
169 0.5
170 0.49
171 0.47
172 0.46
173 0.41
174 0.34
175 0.34
176 0.39
177 0.4
178 0.39
179 0.37
180 0.39
181 0.4
182 0.46
183 0.5
184 0.54
185 0.62
186 0.7
187 0.78
188 0.78
189 0.79
190 0.8
191 0.8
192 0.81
193 0.82
194 0.84
195 0.82
196 0.84
197 0.83
198 0.78
199 0.73
200 0.7
201 0.64
202 0.63
203 0.63
204 0.62
205 0.58
206 0.55
207 0.54
208 0.48
209 0.45
210 0.37
211 0.31
212 0.26
213 0.26
214 0.27
215 0.24
216 0.24
217 0.22
218 0.21
219 0.19
220 0.15
221 0.13
222 0.11
223 0.11
224 0.11
225 0.12
226 0.14
227 0.19
228 0.22
229 0.23
230 0.24
231 0.27
232 0.3
233 0.32
234 0.32
235 0.37
236 0.41
237 0.43
238 0.43
239 0.41
240 0.41
241 0.47
242 0.51
243 0.52
244 0.57
245 0.61
246 0.61
247 0.64
248 0.66
249 0.59
250 0.55
251 0.47