Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1R576

Protein Details
Accession A0A5B1R576    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-77RIPLSYPIPKRPRRPVQGYDDEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 7, mito 6, extr 4, cyto_mito 4, golg 3, vacu 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039961  Nuo9.5  
Gene Ontology GO:0016020  C:membrane  
CDD cd22903  NI9M  
Amino Acid Sequences MASVLSPFRQTYRYLQRQAHEAPVIFYSCVIGSLGPLLAFGVPPIRKQFGWQPAERIPLSYPIPKRPRRPVQGYDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.54
3 0.53
4 0.58
5 0.57
6 0.53
7 0.45
8 0.36
9 0.3
10 0.27
11 0.26
12 0.19
13 0.16
14 0.11
15 0.08
16 0.09
17 0.07
18 0.05
19 0.04
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.08
29 0.08
30 0.1
31 0.12
32 0.15
33 0.15
34 0.17
35 0.25
36 0.3
37 0.36
38 0.36
39 0.38
40 0.39
41 0.45
42 0.42
43 0.36
44 0.28
45 0.28
46 0.3
47 0.32
48 0.33
49 0.38
50 0.48
51 0.54
52 0.62
53 0.68
54 0.75
55 0.78
56 0.82
57 0.81