Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1R4N9

Protein Details
Accession A0A5B1R4N9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
79-99SSYARRHRRMTPHRRFTPRPDBasic
163-191GVQRRRDVVGPRRERRCHRRMTPCCRFAPBasic
NLS Segment(s)
PositionSequence
118-121HRRR
Subcellular Location(s) mito 22, nucl 2.5, cyto_nucl 2.5
Family & Domain DBs
Amino Acid Sequences MTPPRPPRGPRPTVVLCRGPTPYADAPLPAGPATPPSCGAATAARRPVVVSRRGPRYAAAVRRRHCRTTPPLPHDAPLSSYARRHRRMTPHRRFTPRPDDVPPSPYAARPPPLRALLHRRRAAPPPPHDAPLLLYAAARRRPTVAVRRTPPPPAGPATPPSCGVQRRRDVVGPRRERRCHRRMTPCCRFAPWPDDVPPSPSPYAARRPPSAGPAMPPSSYAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.66
3 0.57
4 0.54
5 0.54
6 0.45
7 0.37
8 0.36
9 0.32
10 0.28
11 0.27
12 0.24
13 0.24
14 0.24
15 0.24
16 0.17
17 0.15
18 0.11
19 0.16
20 0.17
21 0.16
22 0.16
23 0.17
24 0.17
25 0.17
26 0.18
27 0.19
28 0.22
29 0.27
30 0.3
31 0.28
32 0.28
33 0.29
34 0.34
35 0.34
36 0.37
37 0.39
38 0.42
39 0.49
40 0.51
41 0.51
42 0.45
43 0.46
44 0.46
45 0.48
46 0.5
47 0.51
48 0.54
49 0.63
50 0.67
51 0.64
52 0.59
53 0.59
54 0.58
55 0.61
56 0.66
57 0.63
58 0.65
59 0.61
60 0.59
61 0.52
62 0.44
63 0.35
64 0.29
65 0.25
66 0.19
67 0.23
68 0.3
69 0.37
70 0.41
71 0.43
72 0.46
73 0.54
74 0.64
75 0.71
76 0.74
77 0.76
78 0.79
79 0.84
80 0.81
81 0.78
82 0.77
83 0.71
84 0.64
85 0.57
86 0.55
87 0.48
88 0.48
89 0.4
90 0.34
91 0.29
92 0.25
93 0.24
94 0.21
95 0.24
96 0.22
97 0.23
98 0.23
99 0.25
100 0.25
101 0.26
102 0.35
103 0.39
104 0.46
105 0.47
106 0.46
107 0.47
108 0.52
109 0.56
110 0.54
111 0.5
112 0.49
113 0.47
114 0.46
115 0.43
116 0.37
117 0.31
118 0.24
119 0.2
120 0.12
121 0.11
122 0.1
123 0.15
124 0.18
125 0.17
126 0.16
127 0.17
128 0.19
129 0.26
130 0.34
131 0.38
132 0.42
133 0.46
134 0.5
135 0.51
136 0.52
137 0.49
138 0.41
139 0.37
140 0.32
141 0.31
142 0.29
143 0.32
144 0.31
145 0.3
146 0.29
147 0.27
148 0.28
149 0.31
150 0.35
151 0.38
152 0.42
153 0.44
154 0.46
155 0.5
156 0.54
157 0.58
158 0.62
159 0.64
160 0.66
161 0.71
162 0.76
163 0.81
164 0.82
165 0.81
166 0.81
167 0.81
168 0.83
169 0.84
170 0.88
171 0.88
172 0.86
173 0.8
174 0.74
175 0.68
176 0.62
177 0.57
178 0.51
179 0.46
180 0.42
181 0.45
182 0.42
183 0.44
184 0.4
185 0.39
186 0.35
187 0.32
188 0.31
189 0.31
190 0.4
191 0.42
192 0.46
193 0.44
194 0.48
195 0.5
196 0.52
197 0.52
198 0.44
199 0.41
200 0.42
201 0.42
202 0.37
203 0.35