Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QMR5

Protein Details
Accession A0A5B1QMR5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-66AWPHQDRRRRFRSCHFRKKLSRHRVPRVDSBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MRAEFPDDPSWASRSGTLKWCFGFGEAFRMSTWARMAWPHQDRRRRFRSCHFRKKLSRHRVPRVDSGALDSFIAITGTASMYQPSIIETASHQKAYSRPWLHVRILHGHMCFHLAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.33
4 0.34
5 0.35
6 0.34
7 0.35
8 0.3
9 0.28
10 0.27
11 0.18
12 0.23
13 0.19
14 0.2
15 0.18
16 0.2
17 0.19
18 0.17
19 0.17
20 0.11
21 0.11
22 0.13
23 0.15
24 0.22
25 0.29
26 0.37
27 0.44
28 0.52
29 0.59
30 0.66
31 0.74
32 0.71
33 0.69
34 0.7
35 0.74
36 0.76
37 0.8
38 0.79
39 0.78
40 0.8
41 0.86
42 0.86
43 0.85
44 0.84
45 0.82
46 0.85
47 0.83
48 0.78
49 0.74
50 0.68
51 0.58
52 0.48
53 0.43
54 0.34
55 0.26
56 0.22
57 0.15
58 0.1
59 0.09
60 0.09
61 0.05
62 0.03
63 0.03
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.08
76 0.16
77 0.19
78 0.19
79 0.18
80 0.21
81 0.23
82 0.28
83 0.36
84 0.31
85 0.33
86 0.41
87 0.46
88 0.48
89 0.48
90 0.48
91 0.45
92 0.48
93 0.48
94 0.41
95 0.37
96 0.33