Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1RCR1

Protein Details
Accession A0A5B1RCR1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
37-62ITYGGSCCHHCRRRRRRSLTARLLILHydrophilic
176-195ACTGTCRPRRHLRTVPPLTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12cyto_nucl 12, cyto 10, mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQRAQHKGGAGQREVAHEGVGRGWGEGGEGQNIQNKITYGGSCCHHCRRRRRRSLTARLLILPPLAVGCCHVYTLSLRCAHSHLPPLLLPPTCSSSSSCRRRCRSLIARPFIPLPLAVGCVHCHLLPPLLPPTCSAPRCRLPHPDLHAPLPLVLHMRPVPVCTTASGSTATARSTACTGTCRPRRHLRTVPPLTPAPPHALAWATTARTARVRQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.28
4 0.21
5 0.21
6 0.16
7 0.17
8 0.13
9 0.11
10 0.11
11 0.1
12 0.09
13 0.11
14 0.11
15 0.11
16 0.11
17 0.12
18 0.18
19 0.18
20 0.18
21 0.17
22 0.16
23 0.16
24 0.18
25 0.18
26 0.15
27 0.18
28 0.21
29 0.24
30 0.3
31 0.38
32 0.43
33 0.5
34 0.59
35 0.67
36 0.76
37 0.82
38 0.86
39 0.87
40 0.9
41 0.93
42 0.93
43 0.88
44 0.79
45 0.7
46 0.61
47 0.51
48 0.4
49 0.28
50 0.17
51 0.11
52 0.08
53 0.06
54 0.06
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.1
61 0.13
62 0.16
63 0.18
64 0.18
65 0.19
66 0.21
67 0.22
68 0.23
69 0.26
70 0.22
71 0.2
72 0.2
73 0.21
74 0.22
75 0.2
76 0.19
77 0.15
78 0.18
79 0.17
80 0.18
81 0.18
82 0.21
83 0.31
84 0.4
85 0.47
86 0.52
87 0.56
88 0.6
89 0.61
90 0.64
91 0.64
92 0.64
93 0.66
94 0.61
95 0.58
96 0.53
97 0.51
98 0.41
99 0.31
100 0.21
101 0.12
102 0.08
103 0.09
104 0.08
105 0.08
106 0.09
107 0.1
108 0.1
109 0.09
110 0.09
111 0.08
112 0.09
113 0.09
114 0.1
115 0.14
116 0.14
117 0.15
118 0.15
119 0.21
120 0.27
121 0.28
122 0.28
123 0.29
124 0.37
125 0.41
126 0.44
127 0.47
128 0.43
129 0.49
130 0.53
131 0.56
132 0.5
133 0.48
134 0.46
135 0.37
136 0.34
137 0.27
138 0.21
139 0.14
140 0.12
141 0.14
142 0.12
143 0.14
144 0.14
145 0.15
146 0.16
147 0.15
148 0.16
149 0.14
150 0.17
151 0.16
152 0.17
153 0.17
154 0.16
155 0.16
156 0.16
157 0.15
158 0.13
159 0.12
160 0.12
161 0.12
162 0.13
163 0.13
164 0.15
165 0.2
166 0.28
167 0.37
168 0.41
169 0.48
170 0.58
171 0.64
172 0.7
173 0.75
174 0.75
175 0.78
176 0.81
177 0.76
178 0.71
179 0.66
180 0.59
181 0.52
182 0.45
183 0.4
184 0.33
185 0.3
186 0.27
187 0.26
188 0.24
189 0.24
190 0.26
191 0.21
192 0.22
193 0.22
194 0.23
195 0.27