Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W270

Protein Details
Accession H1W270    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
85-110NWRNLRQPAPTQQRKKLTRRLTGRLWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11, cyto 5, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MNQGADPVAHLRRFMSERMAEEEAAQRARDFRPLEDPYLVGEEAAASARRERLARETGDDILWDEDRRWNRFLAQMQTWEDRDRNWRNLRQPAPTQQRKKLTRRLTGRLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.27
4 0.29
5 0.34
6 0.35
7 0.3
8 0.29
9 0.31
10 0.27
11 0.25
12 0.23
13 0.17
14 0.18
15 0.19
16 0.24
17 0.21
18 0.2
19 0.27
20 0.3
21 0.32
22 0.3
23 0.29
24 0.24
25 0.25
26 0.22
27 0.13
28 0.11
29 0.08
30 0.07
31 0.08
32 0.07
33 0.05
34 0.06
35 0.07
36 0.09
37 0.09
38 0.1
39 0.14
40 0.18
41 0.18
42 0.2
43 0.21
44 0.2
45 0.2
46 0.19
47 0.14
48 0.12
49 0.12
50 0.09
51 0.08
52 0.13
53 0.17
54 0.2
55 0.21
56 0.2
57 0.21
58 0.26
59 0.31
60 0.31
61 0.3
62 0.31
63 0.34
64 0.36
65 0.36
66 0.34
67 0.29
68 0.26
69 0.33
70 0.35
71 0.41
72 0.46
73 0.52
74 0.57
75 0.66
76 0.69
77 0.67
78 0.67
79 0.69
80 0.71
81 0.75
82 0.75
83 0.74
84 0.8
85 0.81
86 0.84
87 0.83
88 0.82
89 0.82
90 0.82