Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1R4G9

Protein Details
Accession A0A5B1R4G9    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
216-242GESNEERARKNKKARQQRDYRARDKGIBasic
NLS Segment(s)
PositionSequence
192-201RGQKRKSRKG
222-231RARKNKKARQ
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MYSSSRANPRQPYSWAGAANQVSGSSSHAAAPPAATYSQTSATQAGYRKERSYPPAEAYTGNNSYEINHQHGTSFQAPGNPMLHPSYDPHHDQFTAALESAFPYLHTPQIGRTAPVTGEFAYKGYTPANLATNFPHSSYSELANYAGDHRPADNAPGAVQAAVVPGKFAAPSSMHHEHTNERRTSIAEPSARGQKRKSRKGATAAPVSPQGESLGGESNEERARKNKKARQQRDYRARDKGIVDELEGILPDGYKTNDPRAIRKKVARAELEDSQVLNISKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.47
3 0.39
4 0.4
5 0.36
6 0.33
7 0.28
8 0.22
9 0.17
10 0.16
11 0.17
12 0.12
13 0.12
14 0.13
15 0.14
16 0.15
17 0.15
18 0.15
19 0.13
20 0.13
21 0.13
22 0.12
23 0.12
24 0.14
25 0.17
26 0.17
27 0.18
28 0.17
29 0.18
30 0.21
31 0.24
32 0.27
33 0.31
34 0.34
35 0.35
36 0.39
37 0.43
38 0.46
39 0.47
40 0.46
41 0.44
42 0.44
43 0.43
44 0.4
45 0.37
46 0.37
47 0.33
48 0.29
49 0.24
50 0.2
51 0.2
52 0.24
53 0.24
54 0.22
55 0.21
56 0.2
57 0.2
58 0.21
59 0.25
60 0.22
61 0.21
62 0.17
63 0.19
64 0.2
65 0.22
66 0.22
67 0.17
68 0.17
69 0.16
70 0.16
71 0.14
72 0.15
73 0.16
74 0.19
75 0.22
76 0.22
77 0.23
78 0.22
79 0.21
80 0.2
81 0.19
82 0.16
83 0.13
84 0.11
85 0.09
86 0.09
87 0.1
88 0.09
89 0.06
90 0.07
91 0.08
92 0.09
93 0.1
94 0.09
95 0.1
96 0.18
97 0.18
98 0.17
99 0.17
100 0.16
101 0.16
102 0.17
103 0.17
104 0.1
105 0.1
106 0.1
107 0.09
108 0.09
109 0.09
110 0.09
111 0.08
112 0.08
113 0.08
114 0.09
115 0.12
116 0.12
117 0.12
118 0.12
119 0.16
120 0.16
121 0.16
122 0.16
123 0.13
124 0.14
125 0.15
126 0.15
127 0.12
128 0.11
129 0.11
130 0.1
131 0.1
132 0.1
133 0.1
134 0.1
135 0.09
136 0.09
137 0.1
138 0.1
139 0.12
140 0.1
141 0.09
142 0.09
143 0.09
144 0.09
145 0.07
146 0.07
147 0.05
148 0.05
149 0.05
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.06
157 0.06
158 0.08
159 0.16
160 0.2
161 0.22
162 0.23
163 0.25
164 0.29
165 0.36
166 0.42
167 0.35
168 0.32
169 0.31
170 0.32
171 0.32
172 0.3
173 0.29
174 0.22
175 0.23
176 0.26
177 0.35
178 0.36
179 0.37
180 0.39
181 0.42
182 0.5
183 0.59
184 0.65
185 0.63
186 0.67
187 0.72
188 0.76
189 0.73
190 0.7
191 0.61
192 0.54
193 0.5
194 0.44
195 0.36
196 0.27
197 0.21
198 0.14
199 0.13
200 0.12
201 0.13
202 0.12
203 0.13
204 0.13
205 0.16
206 0.19
207 0.2
208 0.2
209 0.24
210 0.32
211 0.4
212 0.51
213 0.55
214 0.62
215 0.72
216 0.81
217 0.84
218 0.87
219 0.89
220 0.89
221 0.9
222 0.88
223 0.85
224 0.78
225 0.72
226 0.63
227 0.56
228 0.51
229 0.42
230 0.36
231 0.29
232 0.27
233 0.22
234 0.2
235 0.16
236 0.1
237 0.09
238 0.08
239 0.08
240 0.1
241 0.14
242 0.18
243 0.24
244 0.3
245 0.33
246 0.43
247 0.5
248 0.57
249 0.61
250 0.66
251 0.69
252 0.71
253 0.77
254 0.72
255 0.69
256 0.67
257 0.63
258 0.59
259 0.51
260 0.43
261 0.35
262 0.33