Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VQY8

Protein Details
Accession H1VQY8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
137-159EKLVPKMAPKIRRREEREKAEAPBasic
NLS Segment(s)
PositionSequence
141-154PKMAPKIRRREEXR
Subcellular Location(s) nucl 14, mito 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MASDEIIWQIINQQFCSFKLSTTKKQTFCRNENNVTGLCNRQSCPLANSRYATVRRAPNKDTLYLYMKTVERAHMPSKLWERIKLPNNYAKALEMLDDKLIYWPKFLIHKCKQRLTRLTQVNIRMRKIAAEEERMGEKLVPKMAPKIRRREEXREXKAEAPGAGEVISCISS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.28
4 0.22
5 0.21
6 0.3
7 0.36
8 0.43
9 0.53
10 0.6
11 0.61
12 0.69
13 0.77
14 0.76
15 0.77
16 0.78
17 0.75
18 0.72
19 0.68
20 0.64
21 0.54
22 0.47
23 0.41
24 0.34
25 0.29
26 0.26
27 0.24
28 0.24
29 0.26
30 0.25
31 0.26
32 0.3
33 0.31
34 0.32
35 0.33
36 0.31
37 0.35
38 0.36
39 0.35
40 0.33
41 0.38
42 0.42
43 0.45
44 0.45
45 0.47
46 0.47
47 0.48
48 0.43
49 0.39
50 0.36
51 0.32
52 0.3
53 0.26
54 0.23
55 0.23
56 0.22
57 0.19
58 0.16
59 0.19
60 0.2
61 0.2
62 0.21
63 0.24
64 0.28
65 0.33
66 0.32
67 0.32
68 0.33
69 0.37
70 0.44
71 0.42
72 0.4
73 0.39
74 0.4
75 0.38
76 0.36
77 0.28
78 0.21
79 0.18
80 0.15
81 0.1
82 0.09
83 0.08
84 0.08
85 0.07
86 0.1
87 0.13
88 0.12
89 0.12
90 0.12
91 0.13
92 0.2
93 0.23
94 0.3
95 0.35
96 0.45
97 0.51
98 0.59
99 0.64
100 0.66
101 0.71
102 0.69
103 0.69
104 0.67
105 0.66
106 0.63
107 0.65
108 0.64
109 0.61
110 0.56
111 0.48
112 0.41
113 0.37
114 0.34
115 0.33
116 0.28
117 0.29
118 0.29
119 0.29
120 0.31
121 0.3
122 0.28
123 0.22
124 0.21
125 0.19
126 0.21
127 0.21
128 0.21
129 0.29
130 0.36
131 0.44
132 0.49
133 0.56
134 0.62
135 0.71
136 0.78
137 0.81
138 0.84
139 0.84
140 0.85
141 0.78
142 0.72
143 0.65
144 0.58
145 0.49
146 0.4
147 0.31
148 0.22
149 0.18
150 0.14