Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1V5X0

Protein Details
Accession H1V5X0   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-72RSPPQLDERRSRRQKHPFHELNBasic
NLS Segment(s)
Subcellular Location(s) nucl 9, mito 8, extr 8
Family & Domain DBs
Amino Acid Sequences MQLLAGISCCLSQIDSRARDGERKRSGATSRQPNLTSPKDQHSHHVSAVARSPPQLDERRSRRQKHPFXHELNQQLLSAVTX
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.26
4 0.29
5 0.3
6 0.37
7 0.41
8 0.45
9 0.44
10 0.45
11 0.45
12 0.47
13 0.49
14 0.49
15 0.53
16 0.53
17 0.49
18 0.51
19 0.5
20 0.47
21 0.5
22 0.46
23 0.41
24 0.34
25 0.36
26 0.35
27 0.35
28 0.38
29 0.37
30 0.35
31 0.31
32 0.33
33 0.28
34 0.26
35 0.29
36 0.26
37 0.2
38 0.18
39 0.19
40 0.16
41 0.22
42 0.27
43 0.28
44 0.36
45 0.43
46 0.54
47 0.62
48 0.68
49 0.71
50 0.76
51 0.81
52 0.79
53 0.83
54 0.8
55 0.76
56 0.79
57 0.74
58 0.7
59 0.61
60 0.53