Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QJA8

Protein Details
Accession A0A5B1QJA8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
98-123RTNNCGARRLDRRKPRRAGLIRIEHAHydrophilic
NLS Segment(s)
PositionSequence
106-116RLDRRKPRRAG
Subcellular Location(s) mito 9, extr 8, nucl 3, cyto 3, plas 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MAPTGPTCACHHCAPAAMCFSLRVHSPPYPGNCRGQCRRLRHDLLHSSCGARRLAIPIPSVITVLISPLPPSPHLSSLLSTPHLRLPEKASVLPGCIRTNNCGARRLDRRKPRRAGLIRIEHAHLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.28
4 0.25
5 0.23
6 0.23
7 0.22
8 0.19
9 0.18
10 0.16
11 0.18
12 0.2
13 0.23
14 0.27
15 0.33
16 0.38
17 0.4
18 0.46
19 0.47
20 0.52
21 0.56
22 0.59
23 0.6
24 0.62
25 0.66
26 0.66
27 0.66
28 0.62
29 0.64
30 0.65
31 0.61
32 0.56
33 0.49
34 0.42
35 0.38
36 0.36
37 0.28
38 0.19
39 0.15
40 0.15
41 0.18
42 0.18
43 0.17
44 0.15
45 0.16
46 0.15
47 0.15
48 0.11
49 0.08
50 0.06
51 0.06
52 0.06
53 0.05
54 0.05
55 0.06
56 0.07
57 0.08
58 0.12
59 0.13
60 0.14
61 0.16
62 0.17
63 0.16
64 0.17
65 0.19
66 0.17
67 0.16
68 0.16
69 0.16
70 0.19
71 0.19
72 0.19
73 0.22
74 0.25
75 0.28
76 0.27
77 0.27
78 0.25
79 0.26
80 0.27
81 0.26
82 0.22
83 0.23
84 0.24
85 0.24
86 0.31
87 0.37
88 0.37
89 0.4
90 0.41
91 0.46
92 0.56
93 0.62
94 0.64
95 0.68
96 0.75
97 0.78
98 0.84
99 0.83
100 0.83
101 0.82
102 0.81
103 0.81
104 0.81
105 0.76
106 0.71