Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1RCC1

Protein Details
Accession A0A5B1RCC1    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
194-220SRPSLPCPTRPSRRRRARRTPIMPVMPHydrophilic
309-330APVARSSRRRARRAPLGPRSVVHydrophilic
361-391LMPPSSPSRPLRRSRLSCRSRRPCTCPAPTYHydrophilic
NLS Segment(s)
PositionSequence
152-183RRPLSPRRPLSPRRPRVAPVTPPSRSRRARRA
203-213RPSRRRRARRT
300-304ARRAR
308-323VAPVARSSRRRARRAP
Subcellular Location(s) mito 12, nucl 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MLDCRRGFDLSSRSLTVPSLPSIRQAFFAPSCRRSVALSRPSHPLRAVAPISLVLRPPSLPPRRALISARCSAIAPFSRPSRPRHVVLSSRRCRVVTPVPPLAPFSCPSRLCGRTRVAPLAPLAPLAPLAPLAPLVPPSRPLVAPLAPVSLRRPLSPRRPLSPRRPRVAPVTPPSRSRRARRAPIVPVTSLVPSRPSLPCPTRPSRRRRARRTPIMPVMPLVPSRARHAGRVRRAVGTSTPLSAAAQLSHSSRIRRAVAPLAAVALSRLSLPSRHRARRAPLGPGPVVVPLAHPSSPLRARRARCAPVAPVARSSRRRARRAPLGPRSVVVPLARPSCPLCSSCARHAARAVVPVMPLWALMPPSSPSRPLRRSRLSCRSRRPCTCPAPTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.32
4 0.28
5 0.26
6 0.26
7 0.23
8 0.29
9 0.32
10 0.32
11 0.3
12 0.29
13 0.31
14 0.3
15 0.39
16 0.4
17 0.39
18 0.42
19 0.42
20 0.41
21 0.39
22 0.43
23 0.44
24 0.46
25 0.49
26 0.49
27 0.57
28 0.58
29 0.58
30 0.51
31 0.44
32 0.37
33 0.39
34 0.37
35 0.28
36 0.26
37 0.25
38 0.26
39 0.24
40 0.23
41 0.16
42 0.16
43 0.16
44 0.2
45 0.27
46 0.34
47 0.35
48 0.37
49 0.41
50 0.43
51 0.47
52 0.48
53 0.47
54 0.46
55 0.47
56 0.45
57 0.4
58 0.37
59 0.33
60 0.34
61 0.29
62 0.25
63 0.26
64 0.29
65 0.37
66 0.41
67 0.47
68 0.5
69 0.52
70 0.52
71 0.53
72 0.56
73 0.57
74 0.63
75 0.69
76 0.66
77 0.65
78 0.65
79 0.59
80 0.52
81 0.5
82 0.49
83 0.47
84 0.47
85 0.48
86 0.47
87 0.47
88 0.49
89 0.43
90 0.35
91 0.28
92 0.25
93 0.26
94 0.25
95 0.28
96 0.33
97 0.37
98 0.37
99 0.43
100 0.42
101 0.41
102 0.45
103 0.47
104 0.4
105 0.37
106 0.35
107 0.3
108 0.26
109 0.2
110 0.15
111 0.1
112 0.1
113 0.08
114 0.07
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.08
122 0.09
123 0.09
124 0.11
125 0.13
126 0.15
127 0.14
128 0.16
129 0.17
130 0.16
131 0.18
132 0.16
133 0.17
134 0.15
135 0.16
136 0.16
137 0.19
138 0.18
139 0.18
140 0.23
141 0.28
142 0.37
143 0.46
144 0.49
145 0.49
146 0.58
147 0.65
148 0.71
149 0.75
150 0.73
151 0.69
152 0.68
153 0.64
154 0.63
155 0.62
156 0.58
157 0.54
158 0.54
159 0.5
160 0.53
161 0.55
162 0.57
163 0.57
164 0.56
165 0.59
166 0.61
167 0.67
168 0.68
169 0.69
170 0.66
171 0.66
172 0.62
173 0.52
174 0.43
175 0.35
176 0.29
177 0.23
178 0.17
179 0.12
180 0.1
181 0.13
182 0.13
183 0.14
184 0.19
185 0.22
186 0.29
187 0.35
188 0.42
189 0.5
190 0.57
191 0.64
192 0.69
193 0.76
194 0.8
195 0.83
196 0.87
197 0.87
198 0.9
199 0.87
200 0.85
201 0.81
202 0.73
203 0.63
204 0.52
205 0.43
206 0.33
207 0.27
208 0.2
209 0.15
210 0.13
211 0.17
212 0.23
213 0.22
214 0.27
215 0.36
216 0.42
217 0.47
218 0.54
219 0.52
220 0.48
221 0.48
222 0.44
223 0.36
224 0.32
225 0.25
226 0.19
227 0.17
228 0.15
229 0.14
230 0.13
231 0.12
232 0.08
233 0.08
234 0.08
235 0.09
236 0.14
237 0.16
238 0.17
239 0.19
240 0.24
241 0.26
242 0.26
243 0.28
244 0.28
245 0.27
246 0.26
247 0.24
248 0.2
249 0.16
250 0.15
251 0.12
252 0.06
253 0.05
254 0.05
255 0.05
256 0.05
257 0.09
258 0.13
259 0.22
260 0.32
261 0.39
262 0.45
263 0.51
264 0.57
265 0.63
266 0.64
267 0.62
268 0.57
269 0.57
270 0.51
271 0.45
272 0.39
273 0.29
274 0.26
275 0.18
276 0.14
277 0.1
278 0.13
279 0.12
280 0.12
281 0.13
282 0.19
283 0.26
284 0.3
285 0.36
286 0.41
287 0.44
288 0.53
289 0.61
290 0.59
291 0.56
292 0.56
293 0.51
294 0.53
295 0.56
296 0.47
297 0.45
298 0.46
299 0.5
300 0.51
301 0.56
302 0.57
303 0.61
304 0.67
305 0.69
306 0.73
307 0.75
308 0.8
309 0.83
310 0.82
311 0.8
312 0.73
313 0.66
314 0.58
315 0.49
316 0.42
317 0.32
318 0.27
319 0.24
320 0.27
321 0.27
322 0.27
323 0.28
324 0.29
325 0.31
326 0.27
327 0.27
328 0.32
329 0.37
330 0.41
331 0.49
332 0.46
333 0.46
334 0.48
335 0.49
336 0.43
337 0.42
338 0.38
339 0.29
340 0.27
341 0.24
342 0.22
343 0.16
344 0.14
345 0.09
346 0.1
347 0.09
348 0.09
349 0.11
350 0.12
351 0.18
352 0.21
353 0.27
354 0.32
355 0.42
356 0.51
357 0.58
358 0.66
359 0.71
360 0.78
361 0.82
362 0.86
363 0.86
364 0.88
365 0.9
366 0.9
367 0.9
368 0.9
369 0.88
370 0.87
371 0.87