Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QIH9

Protein Details
Accession A0A5B1QIH9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
148-173RTTEPATKAQQPRKTRRRAVDRFEMKHydrophilic
NLS Segment(s)
PositionSequence
155-185KAQQPRKTRRRAVDRFEMKVKRIMEDSRRRR
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MSSHTMYSPPPSVPSSSSSSSSSHYTVFTVGLELRVHSYAVAHPRFSTSAVCPNIPTATLCSGMTPDGERCLHTSSSPCRSDEAEQRSAARARLAAVLPIRHYVHGETVEGFEEESRWAGDKRQRVFAGIRCLPAEELQMRPAIRKIRTTEPATKAQQPRKTRRRAVDRFEMKVKRIMEDSRRRRRILEDNVDVVVASEVCMAQENVEGTDTEPATEPFDFGKIVPTSLVKKERLEKTHRRRANRVQTALGKYGPAWGALFRKTYTPAATGRICGVRDRRVRYLQPSTPVTNDSDQPSSPIPTSPTPTPQPASALPLEPSPPPSPVLPSAPAPQPAPIQPRAPTPPRAPTPPAPASRPAPPSPPTAGPSTLPLPLVQSVLAPASTYYRLPSVQSIPLFTRDAAPRRGFASSAATFGCIAAPRSVQRKPLSKYDFEVSMSDMADHLAFNTVRYDEPVAPQRPENVSAQEAKLAIFGDSDSEDSDEEDEEDEEDMEDAGEGGGEEEGEEGGGEEDDADADDAMEDREQEGAGDDSDIEADDSPAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.32
4 0.33
5 0.32
6 0.31
7 0.31
8 0.33
9 0.3
10 0.26
11 0.23
12 0.22
13 0.2
14 0.19
15 0.17
16 0.15
17 0.14
18 0.15
19 0.15
20 0.15
21 0.16
22 0.16
23 0.16
24 0.13
25 0.14
26 0.17
27 0.26
28 0.28
29 0.26
30 0.26
31 0.29
32 0.31
33 0.3
34 0.29
35 0.23
36 0.3
37 0.32
38 0.32
39 0.29
40 0.3
41 0.3
42 0.27
43 0.24
44 0.19
45 0.18
46 0.19
47 0.18
48 0.17
49 0.17
50 0.16
51 0.16
52 0.15
53 0.14
54 0.17
55 0.18
56 0.19
57 0.2
58 0.24
59 0.23
60 0.23
61 0.29
62 0.31
63 0.39
64 0.41
65 0.39
66 0.37
67 0.4
68 0.44
69 0.46
70 0.46
71 0.43
72 0.41
73 0.42
74 0.45
75 0.44
76 0.39
77 0.32
78 0.24
79 0.21
80 0.24
81 0.23
82 0.22
83 0.23
84 0.24
85 0.23
86 0.27
87 0.27
88 0.22
89 0.24
90 0.21
91 0.22
92 0.21
93 0.21
94 0.17
95 0.17
96 0.17
97 0.16
98 0.14
99 0.1
100 0.09
101 0.09
102 0.08
103 0.08
104 0.09
105 0.1
106 0.16
107 0.23
108 0.29
109 0.33
110 0.4
111 0.4
112 0.41
113 0.46
114 0.45
115 0.49
116 0.44
117 0.42
118 0.34
119 0.35
120 0.32
121 0.28
122 0.27
123 0.19
124 0.17
125 0.17
126 0.2
127 0.19
128 0.2
129 0.23
130 0.26
131 0.26
132 0.31
133 0.34
134 0.39
135 0.46
136 0.51
137 0.56
138 0.54
139 0.6
140 0.58
141 0.62
142 0.62
143 0.63
144 0.65
145 0.66
146 0.72
147 0.74
148 0.8
149 0.8
150 0.81
151 0.84
152 0.85
153 0.82
154 0.82
155 0.78
156 0.73
157 0.74
158 0.68
159 0.58
160 0.55
161 0.48
162 0.39
163 0.36
164 0.37
165 0.38
166 0.45
167 0.54
168 0.6
169 0.65
170 0.64
171 0.63
172 0.64
173 0.64
174 0.63
175 0.62
176 0.55
177 0.5
178 0.49
179 0.47
180 0.4
181 0.3
182 0.2
183 0.1
184 0.06
185 0.04
186 0.04
187 0.04
188 0.05
189 0.05
190 0.05
191 0.06
192 0.07
193 0.07
194 0.07
195 0.07
196 0.07
197 0.1
198 0.1
199 0.09
200 0.09
201 0.09
202 0.11
203 0.11
204 0.11
205 0.08
206 0.09
207 0.09
208 0.08
209 0.13
210 0.11
211 0.11
212 0.12
213 0.13
214 0.15
215 0.2
216 0.26
217 0.22
218 0.25
219 0.33
220 0.39
221 0.44
222 0.5
223 0.55
224 0.61
225 0.69
226 0.72
227 0.7
228 0.72
229 0.76
230 0.78
231 0.75
232 0.68
233 0.62
234 0.63
235 0.6
236 0.53
237 0.43
238 0.32
239 0.23
240 0.23
241 0.18
242 0.13
243 0.09
244 0.1
245 0.11
246 0.13
247 0.14
248 0.12
249 0.13
250 0.15
251 0.16
252 0.15
253 0.16
254 0.16
255 0.19
256 0.19
257 0.18
258 0.17
259 0.18
260 0.17
261 0.18
262 0.2
263 0.24
264 0.3
265 0.34
266 0.38
267 0.41
268 0.43
269 0.46
270 0.5
271 0.45
272 0.44
273 0.43
274 0.39
275 0.35
276 0.34
277 0.3
278 0.24
279 0.23
280 0.2
281 0.18
282 0.16
283 0.17
284 0.17
285 0.16
286 0.15
287 0.14
288 0.14
289 0.14
290 0.18
291 0.18
292 0.21
293 0.22
294 0.25
295 0.25
296 0.22
297 0.24
298 0.2
299 0.23
300 0.19
301 0.18
302 0.15
303 0.15
304 0.16
305 0.13
306 0.17
307 0.14
308 0.14
309 0.15
310 0.14
311 0.16
312 0.17
313 0.19
314 0.17
315 0.18
316 0.2
317 0.21
318 0.23
319 0.2
320 0.2
321 0.19
322 0.22
323 0.25
324 0.24
325 0.24
326 0.24
327 0.29
328 0.33
329 0.36
330 0.37
331 0.36
332 0.41
333 0.42
334 0.46
335 0.46
336 0.44
337 0.48
338 0.5
339 0.49
340 0.44
341 0.45
342 0.43
343 0.44
344 0.45
345 0.38
346 0.36
347 0.35
348 0.36
349 0.36
350 0.36
351 0.32
352 0.29
353 0.29
354 0.24
355 0.25
356 0.23
357 0.2
358 0.18
359 0.15
360 0.14
361 0.14
362 0.14
363 0.11
364 0.09
365 0.08
366 0.08
367 0.08
368 0.06
369 0.06
370 0.08
371 0.09
372 0.09
373 0.1
374 0.11
375 0.12
376 0.13
377 0.17
378 0.18
379 0.21
380 0.22
381 0.23
382 0.23
383 0.26
384 0.26
385 0.23
386 0.25
387 0.26
388 0.3
389 0.34
390 0.34
391 0.32
392 0.33
393 0.34
394 0.28
395 0.24
396 0.26
397 0.2
398 0.2
399 0.19
400 0.18
401 0.17
402 0.16
403 0.17
404 0.1
405 0.11
406 0.11
407 0.13
408 0.17
409 0.22
410 0.25
411 0.31
412 0.36
413 0.44
414 0.46
415 0.55
416 0.57
417 0.54
418 0.55
419 0.51
420 0.48
421 0.4
422 0.37
423 0.29
424 0.25
425 0.22
426 0.18
427 0.14
428 0.12
429 0.1
430 0.09
431 0.08
432 0.1
433 0.1
434 0.1
435 0.13
436 0.13
437 0.13
438 0.16
439 0.19
440 0.16
441 0.22
442 0.31
443 0.32
444 0.34
445 0.35
446 0.38
447 0.37
448 0.39
449 0.36
450 0.31
451 0.31
452 0.32
453 0.31
454 0.28
455 0.25
456 0.22
457 0.21
458 0.17
459 0.14
460 0.1
461 0.1
462 0.09
463 0.09
464 0.1
465 0.1
466 0.1
467 0.1
468 0.1
469 0.11
470 0.1
471 0.1
472 0.1
473 0.1
474 0.09
475 0.1
476 0.09
477 0.09
478 0.08
479 0.08
480 0.07
481 0.06
482 0.05
483 0.05
484 0.04
485 0.04
486 0.04
487 0.04
488 0.04
489 0.04
490 0.04
491 0.04
492 0.04
493 0.04
494 0.04
495 0.05
496 0.05
497 0.05
498 0.04
499 0.05
500 0.05
501 0.06
502 0.06
503 0.05
504 0.05
505 0.06
506 0.06
507 0.07
508 0.08
509 0.07
510 0.07
511 0.08
512 0.08
513 0.08
514 0.1
515 0.1
516 0.1
517 0.1
518 0.1
519 0.09
520 0.1
521 0.1
522 0.08
523 0.08