Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1W3C3

Protein Details
Accession H1W3C3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-67MSTSSGRRRLRRQARRANVACAHydrophilic
NLS Segment(s)
PositionSequence
54-56RLR
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences EALRQPVQPQETRQGETRAQGHDALRQEAERPLLQQQAPREILQAMSTSSGRRRLRRQARRANVACAWRYWVPLRRHRGSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.43
4 0.42
5 0.34
6 0.32
7 0.32
8 0.29
9 0.29
10 0.29
11 0.26
12 0.23
13 0.21
14 0.2
15 0.19
16 0.21
17 0.16
18 0.15
19 0.15
20 0.19
21 0.19
22 0.21
23 0.21
24 0.24
25 0.25
26 0.24
27 0.22
28 0.18
29 0.18
30 0.15
31 0.14
32 0.08
33 0.08
34 0.09
35 0.09
36 0.12
37 0.21
38 0.25
39 0.3
40 0.37
41 0.47
42 0.58
43 0.67
44 0.75
45 0.77
46 0.82
47 0.86
48 0.82
49 0.78
50 0.72
51 0.67
52 0.58
53 0.48
54 0.44
55 0.35
56 0.36
57 0.36
58 0.4
59 0.42
60 0.5
61 0.58