Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1RCY4

Protein Details
Accession A0A5B1RCY4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
175-199LSERWFTYKKNRRLKKSGDRAKDFIHydrophilic
NLS Segment(s)
PositionSequence
186-190RRLKK
Subcellular Location(s) nucl 10, cyto_nucl 8.5, mito 6, cyto 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046496  DUF6589  
Pfam View protein in Pfam  
PF20231  DUF6589  
Amino Acid Sequences MQLHLEQDEVKYQLILFNADVLSYLDLRDATRTGDVGRIEDLIPTLLLRFAGGGNSKYMIEMLELVQGLRCEWPESVKDIVQTHCWLVNRTGRRDGFVLTDLAQEQNIKDLKVTYHSFGPGATLAYLTKISPVVPVLHEVKKHIKWQLETLLTRGDCHSSPNKEKDIEKYANIVLSERWFTYKKNRRLKKSGDRAKDFITEGVTTLFQDKAIERWWKGRSFVRSTQEKWLDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.12
4 0.13
5 0.13
6 0.12
7 0.13
8 0.11
9 0.12
10 0.1
11 0.1
12 0.09
13 0.1
14 0.1
15 0.12
16 0.11
17 0.12
18 0.12
19 0.13
20 0.13
21 0.17
22 0.17
23 0.16
24 0.16
25 0.16
26 0.15
27 0.14
28 0.14
29 0.1
30 0.09
31 0.08
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.08
39 0.11
40 0.11
41 0.12
42 0.13
43 0.13
44 0.12
45 0.12
46 0.1
47 0.08
48 0.08
49 0.07
50 0.08
51 0.08
52 0.08
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.08
59 0.09
60 0.11
61 0.12
62 0.15
63 0.17
64 0.17
65 0.19
66 0.2
67 0.21
68 0.21
69 0.21
70 0.19
71 0.19
72 0.19
73 0.18
74 0.19
75 0.25
76 0.28
77 0.3
78 0.37
79 0.34
80 0.35
81 0.34
82 0.31
83 0.26
84 0.22
85 0.19
86 0.13
87 0.13
88 0.12
89 0.11
90 0.1
91 0.08
92 0.07
93 0.11
94 0.11
95 0.1
96 0.1
97 0.1
98 0.11
99 0.15
100 0.17
101 0.13
102 0.14
103 0.14
104 0.14
105 0.13
106 0.13
107 0.09
108 0.08
109 0.06
110 0.06
111 0.05
112 0.06
113 0.06
114 0.05
115 0.06
116 0.06
117 0.06
118 0.06
119 0.07
120 0.08
121 0.08
122 0.11
123 0.14
124 0.17
125 0.17
126 0.2
127 0.26
128 0.28
129 0.31
130 0.33
131 0.34
132 0.33
133 0.37
134 0.4
135 0.39
136 0.36
137 0.33
138 0.34
139 0.29
140 0.28
141 0.25
142 0.21
143 0.15
144 0.19
145 0.25
146 0.27
147 0.34
148 0.38
149 0.42
150 0.43
151 0.45
152 0.46
153 0.48
154 0.44
155 0.38
156 0.36
157 0.33
158 0.32
159 0.3
160 0.24
161 0.17
162 0.17
163 0.17
164 0.15
165 0.18
166 0.17
167 0.19
168 0.3
169 0.39
170 0.46
171 0.55
172 0.64
173 0.7
174 0.78
175 0.86
176 0.86
177 0.87
178 0.87
179 0.87
180 0.84
181 0.78
182 0.73
183 0.66
184 0.56
185 0.47
186 0.39
187 0.29
188 0.23
189 0.21
190 0.17
191 0.14
192 0.14
193 0.13
194 0.1
195 0.12
196 0.12
197 0.13
198 0.2
199 0.26
200 0.27
201 0.34
202 0.39
203 0.41
204 0.46
205 0.51
206 0.53
207 0.54
208 0.6
209 0.62
210 0.64
211 0.64
212 0.69
213 0.69