Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1RBE0

Protein Details
Accession A0A5B1RBE0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-77FNAFRCCLRPPPPFRARRRRFAPTAHydrophilic
NLS Segment(s)
PositionSequence
68-72ARRRR
208-231RPSIRARAAAVPRTRPPVRHAPRR
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSLCPRRTQPPSARPAAPFRHPRHHLAPAAAFCAPCRAHAAPRRRLCTPPHPFNAFRCCLRPPPPFRARRRRFAPTALAPRRAVSTPLTVVSTPPPPFHTPAVVSMPLPPSRPPPPLYGRPASPSQRPAPPSSGPMGPFCALHHRLRAPPRPFNAPDRRQCAPPRRLNAPSPSMRPAVPSQPPAPPPCAPRAATLILHRATPSQPPPRPSIRARAAAVPRTRPPVRHAPRRVPVAPRCAHVAPHPAPSPLLPLAPPSRALSAPLPPAILSHQAAAASGALRAILTPLAVIARPRTVATTRPHTAVTHPVALPSRRATVTTGRRAVGMRPTSCYALSRFESPSLTPPQRRCLTRCSAISWPAPTPPSCTPMPPSRAPALPHRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.67
4 0.66
5 0.66
6 0.65
7 0.69
8 0.68
9 0.71
10 0.7
11 0.71
12 0.66
13 0.61
14 0.61
15 0.52
16 0.51
17 0.45
18 0.37
19 0.29
20 0.32
21 0.26
22 0.21
23 0.25
24 0.25
25 0.32
26 0.41
27 0.51
28 0.54
29 0.62
30 0.66
31 0.63
32 0.66
33 0.64
34 0.67
35 0.67
36 0.67
37 0.66
38 0.68
39 0.67
40 0.69
41 0.7
42 0.64
43 0.57
44 0.51
45 0.47
46 0.48
47 0.54
48 0.57
49 0.55
50 0.61
51 0.68
52 0.74
53 0.8
54 0.84
55 0.83
56 0.83
57 0.84
58 0.82
59 0.78
60 0.75
61 0.73
62 0.71
63 0.74
64 0.7
65 0.68
66 0.59
67 0.55
68 0.52
69 0.43
70 0.36
71 0.27
72 0.25
73 0.21
74 0.22
75 0.23
76 0.2
77 0.2
78 0.21
79 0.25
80 0.21
81 0.21
82 0.24
83 0.26
84 0.29
85 0.29
86 0.3
87 0.25
88 0.27
89 0.3
90 0.26
91 0.23
92 0.23
93 0.26
94 0.24
95 0.24
96 0.21
97 0.22
98 0.26
99 0.3
100 0.29
101 0.32
102 0.38
103 0.45
104 0.5
105 0.48
106 0.45
107 0.45
108 0.49
109 0.47
110 0.44
111 0.42
112 0.4
113 0.42
114 0.43
115 0.43
116 0.41
117 0.38
118 0.36
119 0.34
120 0.32
121 0.27
122 0.25
123 0.25
124 0.2
125 0.19
126 0.17
127 0.22
128 0.23
129 0.23
130 0.26
131 0.26
132 0.32
133 0.4
134 0.48
135 0.47
136 0.5
137 0.51
138 0.54
139 0.54
140 0.58
141 0.61
142 0.6
143 0.61
144 0.59
145 0.58
146 0.56
147 0.61
148 0.61
149 0.6
150 0.59
151 0.57
152 0.57
153 0.6
154 0.59
155 0.56
156 0.53
157 0.47
158 0.43
159 0.41
160 0.36
161 0.32
162 0.31
163 0.27
164 0.26
165 0.26
166 0.26
167 0.25
168 0.27
169 0.3
170 0.29
171 0.31
172 0.28
173 0.27
174 0.27
175 0.29
176 0.26
177 0.25
178 0.26
179 0.24
180 0.23
181 0.23
182 0.24
183 0.2
184 0.2
185 0.18
186 0.16
187 0.15
188 0.18
189 0.23
190 0.27
191 0.29
192 0.32
193 0.37
194 0.41
195 0.45
196 0.44
197 0.46
198 0.43
199 0.45
200 0.44
201 0.46
202 0.45
203 0.45
204 0.46
205 0.4
206 0.37
207 0.39
208 0.4
209 0.34
210 0.36
211 0.4
212 0.46
213 0.53
214 0.58
215 0.59
216 0.64
217 0.7
218 0.68
219 0.65
220 0.62
221 0.6
222 0.55
223 0.47
224 0.46
225 0.39
226 0.37
227 0.31
228 0.34
229 0.27
230 0.31
231 0.31
232 0.26
233 0.26
234 0.25
235 0.26
236 0.18
237 0.17
238 0.11
239 0.14
240 0.16
241 0.17
242 0.18
243 0.16
244 0.17
245 0.17
246 0.19
247 0.18
248 0.19
249 0.21
250 0.2
251 0.18
252 0.16
253 0.17
254 0.16
255 0.17
256 0.14
257 0.12
258 0.12
259 0.12
260 0.12
261 0.12
262 0.1
263 0.07
264 0.06
265 0.06
266 0.05
267 0.05
268 0.05
269 0.05
270 0.04
271 0.04
272 0.04
273 0.04
274 0.05
275 0.06
276 0.07
277 0.08
278 0.1
279 0.11
280 0.11
281 0.14
282 0.15
283 0.22
284 0.27
285 0.34
286 0.35
287 0.36
288 0.37
289 0.35
290 0.36
291 0.37
292 0.35
293 0.32
294 0.29
295 0.31
296 0.34
297 0.34
298 0.35
299 0.3
300 0.3
301 0.26
302 0.27
303 0.27
304 0.32
305 0.4
306 0.46
307 0.47
308 0.43
309 0.44
310 0.44
311 0.45
312 0.44
313 0.42
314 0.35
315 0.36
316 0.38
317 0.38
318 0.38
319 0.37
320 0.3
321 0.29
322 0.3
323 0.29
324 0.28
325 0.28
326 0.3
327 0.29
328 0.33
329 0.36
330 0.41
331 0.45
332 0.47
333 0.55
334 0.6
335 0.64
336 0.62
337 0.61
338 0.61
339 0.62
340 0.61
341 0.57
342 0.56
343 0.56
344 0.57
345 0.52
346 0.46
347 0.42
348 0.43
349 0.38
350 0.38
351 0.36
352 0.36
353 0.33
354 0.35
355 0.37
356 0.43
357 0.48
358 0.47
359 0.49
360 0.5
361 0.53
362 0.53