Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1R6C0

Protein Details
Accession A0A5B1R6C0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
95-123APSRRPRAPLCPRRRPRAPLCRPRPTPPSHydrophilic
NLS Segment(s)
PositionSequence
107-111RRRPR
Subcellular Location(s) nucl 12, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MRDSSSGLQVRRYVPQDVIEVLTARARDPGLVPTCAQLCPLTPIAHRARPARRTSRLSRSACALTVFLPTPPSATHNAVCVPRRAVSMPRWAICAPSRRPRAPLCPRRRPRAPLCRPRPTPPSSGPAGTSARHVAPSQSPAGLSARPAEPSRWPPGPSSHPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.32
4 0.3
5 0.28
6 0.23
7 0.2
8 0.18
9 0.18
10 0.15
11 0.13
12 0.14
13 0.12
14 0.12
15 0.12
16 0.19
17 0.2
18 0.22
19 0.22
20 0.22
21 0.24
22 0.23
23 0.23
24 0.15
25 0.13
26 0.15
27 0.17
28 0.17
29 0.16
30 0.23
31 0.27
32 0.3
33 0.34
34 0.37
35 0.42
36 0.48
37 0.55
38 0.57
39 0.59
40 0.63
41 0.66
42 0.69
43 0.71
44 0.67
45 0.6
46 0.55
47 0.49
48 0.42
49 0.36
50 0.26
51 0.17
52 0.16
53 0.15
54 0.11
55 0.1
56 0.09
57 0.09
58 0.09
59 0.11
60 0.12
61 0.14
62 0.14
63 0.15
64 0.17
65 0.2
66 0.21
67 0.2
68 0.18
69 0.16
70 0.17
71 0.17
72 0.19
73 0.18
74 0.26
75 0.28
76 0.27
77 0.29
78 0.28
79 0.29
80 0.29
81 0.34
82 0.3
83 0.36
84 0.43
85 0.41
86 0.46
87 0.48
88 0.54
89 0.58
90 0.63
91 0.64
92 0.68
93 0.74
94 0.79
95 0.82
96 0.8
97 0.79
98 0.8
99 0.81
100 0.81
101 0.83
102 0.84
103 0.82
104 0.81
105 0.78
106 0.71
107 0.67
108 0.6
109 0.55
110 0.48
111 0.45
112 0.39
113 0.36
114 0.33
115 0.27
116 0.26
117 0.23
118 0.21
119 0.21
120 0.21
121 0.19
122 0.2
123 0.23
124 0.22
125 0.2
126 0.19
127 0.19
128 0.21
129 0.19
130 0.17
131 0.17
132 0.16
133 0.19
134 0.21
135 0.22
136 0.27
137 0.32
138 0.39
139 0.4
140 0.4
141 0.4
142 0.46