Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QRH6

Protein Details
Accession A0A5B1QRH6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-79AVQGGLSRRCQKKRRPPADHRBasic
NLS Segment(s)
PositionSequence
71-74KRRP
Subcellular Location(s) cyto_nucl 9, nucl 8.5, mito 8, cyto 6.5, extr 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTSGIPCTPSHLSISQCICCCIIFLFVLSLCFTYIEATHESVTGVQYDIVTDLSVKYEAVQGGLSRRCQKKRRPPADHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.32
4 0.32
5 0.28
6 0.24
7 0.23
8 0.17
9 0.14
10 0.1
11 0.09
12 0.09
13 0.09
14 0.09
15 0.09
16 0.08
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.08
23 0.09
24 0.09
25 0.09
26 0.09
27 0.09
28 0.09
29 0.09
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.08
45 0.08
46 0.09
47 0.1
48 0.1
49 0.16
50 0.2
51 0.24
52 0.31
53 0.4
54 0.49
55 0.57
56 0.67
57 0.72
58 0.8
59 0.86