Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1V373

Protein Details
Accession H1V373    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-33SLSSGRKKDRVRVKERVREKWRRRIGKHIHSFIBasic
NLS Segment(s)
PositionSequence
6-27RKKDRVRVKERVREKWRRRIGK
Subcellular Location(s) nucl 13.5, mito_nucl 12.166, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences SLSSGRKKDRVRVKERVREKWRRRIGKHIHSFIHSFLSASVDLSFSPACSWFCPASNVLCMHVCMYLQQTLLHRVLSIRPIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.86
4 0.86
5 0.86
6 0.87
7 0.87
8 0.87
9 0.87
10 0.82
11 0.82
12 0.82
13 0.82
14 0.82
15 0.78
16 0.69
17 0.62
18 0.59
19 0.48
20 0.41
21 0.3
22 0.2
23 0.14
24 0.14
25 0.11
26 0.1
27 0.1
28 0.07
29 0.07
30 0.08
31 0.07
32 0.05
33 0.06
34 0.07
35 0.07
36 0.08
37 0.11
38 0.11
39 0.12
40 0.14
41 0.15
42 0.16
43 0.19
44 0.19
45 0.18
46 0.17
47 0.17
48 0.16
49 0.15
50 0.13
51 0.11
52 0.13
53 0.13
54 0.13
55 0.15
56 0.16
57 0.21
58 0.22
59 0.21
60 0.19
61 0.19
62 0.21