Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QMT7

Protein Details
Accession A0A5B1QMT7    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-33AWNRRDGARTARRRKKGSSATPFVHydrophilic
182-204TPLAPSRRSRPSRRRACRAPVVRHydrophilic
NLS Segment(s)
PositionSequence
12-26NRRDGARTARRRKKG
174-215RRARRPPVTPLAPSRRSRPSRRRACRAPVVRPSRPSCRRALR
251-261RRGLHAPRGPR
Subcellular Location(s) mito 19, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MRGGAGVKGAWNRRDGARTARRRKKGSSATPFVLYPLLIPRALVAPARSSTPHTPFAPSPIFAPSSSRAVSMPACPSRPSPPFGAIWLVSRRSRILTAPSSLRAPRRVAPVGPRAFASLAPSRSSSCFGPSSRPSILPSPRRAVAPLARPSHTSRRRACRAPVTPLVPSRPSCRRARRPPVTPLAPSRRSRPSRRRACRAPVVRPSRPSCRRALRASVAPVARPSHTSRRRACRAPVTPLVPSRPPRPSCRRGLHAPRGPRAAVAPVVRPSRPSCRRAPRTSVASVACPSPRARHRAARGLRAIVPVVPSRPPRPSSAFVLPSRPSRARHALFALPVSCSFAGVVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.44
4 0.49
5 0.57
6 0.66
7 0.73
8 0.78
9 0.79
10 0.82
11 0.82
12 0.82
13 0.82
14 0.81
15 0.79
16 0.73
17 0.69
18 0.63
19 0.53
20 0.43
21 0.32
22 0.23
23 0.2
24 0.19
25 0.16
26 0.16
27 0.16
28 0.16
29 0.18
30 0.18
31 0.14
32 0.15
33 0.16
34 0.19
35 0.19
36 0.23
37 0.29
38 0.32
39 0.37
40 0.34
41 0.38
42 0.37
43 0.42
44 0.4
45 0.33
46 0.29
47 0.27
48 0.27
49 0.22
50 0.26
51 0.22
52 0.23
53 0.23
54 0.23
55 0.2
56 0.21
57 0.22
58 0.21
59 0.26
60 0.26
61 0.27
62 0.28
63 0.3
64 0.35
65 0.37
66 0.36
67 0.32
68 0.31
69 0.3
70 0.3
71 0.31
72 0.24
73 0.26
74 0.27
75 0.27
76 0.25
77 0.26
78 0.26
79 0.24
80 0.25
81 0.23
82 0.25
83 0.25
84 0.28
85 0.29
86 0.3
87 0.32
88 0.33
89 0.35
90 0.33
91 0.33
92 0.32
93 0.36
94 0.37
95 0.36
96 0.39
97 0.45
98 0.43
99 0.4
100 0.36
101 0.31
102 0.29
103 0.27
104 0.24
105 0.2
106 0.19
107 0.2
108 0.2
109 0.2
110 0.21
111 0.23
112 0.19
113 0.17
114 0.19
115 0.19
116 0.24
117 0.25
118 0.29
119 0.28
120 0.29
121 0.28
122 0.31
123 0.38
124 0.39
125 0.41
126 0.4
127 0.4
128 0.39
129 0.38
130 0.35
131 0.32
132 0.33
133 0.36
134 0.35
135 0.35
136 0.37
137 0.4
138 0.47
139 0.49
140 0.49
141 0.49
142 0.55
143 0.61
144 0.63
145 0.63
146 0.62
147 0.59
148 0.58
149 0.55
150 0.48
151 0.44
152 0.42
153 0.4
154 0.33
155 0.3
156 0.29
157 0.3
158 0.33
159 0.38
160 0.46
161 0.54
162 0.62
163 0.71
164 0.74
165 0.73
166 0.75
167 0.75
168 0.69
169 0.61
170 0.59
171 0.56
172 0.55
173 0.51
174 0.49
175 0.51
176 0.54
177 0.61
178 0.64
179 0.66
180 0.71
181 0.78
182 0.82
183 0.8
184 0.81
185 0.81
186 0.77
187 0.75
188 0.73
189 0.73
190 0.68
191 0.67
192 0.64
193 0.64
194 0.64
195 0.59
196 0.57
197 0.58
198 0.6
199 0.58
200 0.6
201 0.54
202 0.52
203 0.51
204 0.49
205 0.41
206 0.35
207 0.32
208 0.28
209 0.23
210 0.22
211 0.24
212 0.3
213 0.37
214 0.45
215 0.49
216 0.57
217 0.63
218 0.64
219 0.64
220 0.63
221 0.6
222 0.58
223 0.55
224 0.48
225 0.44
226 0.42
227 0.41
228 0.37
229 0.37
230 0.37
231 0.41
232 0.43
233 0.49
234 0.57
235 0.6
236 0.64
237 0.68
238 0.68
239 0.69
240 0.76
241 0.77
242 0.74
243 0.74
244 0.7
245 0.66
246 0.6
247 0.5
248 0.41
249 0.33
250 0.31
251 0.25
252 0.24
253 0.26
254 0.29
255 0.29
256 0.31
257 0.32
258 0.38
259 0.43
260 0.44
261 0.48
262 0.56
263 0.66
264 0.7
265 0.74
266 0.72
267 0.71
268 0.69
269 0.64
270 0.55
271 0.49
272 0.42
273 0.37
274 0.3
275 0.26
276 0.25
277 0.28
278 0.33
279 0.36
280 0.42
281 0.48
282 0.54
283 0.62
284 0.67
285 0.68
286 0.66
287 0.64
288 0.6
289 0.53
290 0.47
291 0.38
292 0.35
293 0.28
294 0.25
295 0.27
296 0.29
297 0.32
298 0.38
299 0.39
300 0.42
301 0.46
302 0.49
303 0.5
304 0.53
305 0.56
306 0.52
307 0.56
308 0.54
309 0.53
310 0.56
311 0.54
312 0.48
313 0.49
314 0.57
315 0.53
316 0.55
317 0.55
318 0.51
319 0.49
320 0.5
321 0.43
322 0.35
323 0.32
324 0.31
325 0.25
326 0.21