Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QDD0

Protein Details
Accession A0A5B1QDD0    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
377-399DVPPHRRWPSRKAQKISRQPAVQHydrophilic
NLS Segment(s)
PositionSequence
331-348RRFARRRGSRGRGSTPGR
530-531RR
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MSPGELPYPPQQSHQGQPSQQPQWSSAPHLLPPAHAPPAFAGNPSNSAPPLGDQQQQQQQQQHFPNYYQQGPAGGQAGLPDSAMLDRPTTLSLNLSSLSIASPTNLSPINQSPHTSTATSGVSPITPISPSNPNIQGPSPFGAHHHPSSHPPGAYSQHAPPPSQPQFSFAPPDQGQGIRCEDLHYDLSARRMGLSSRSSSSSEKSVPRKRSITAGPLPTNIEEASMFDRTGGGNGANGAMQLDGPGDGYDEVDMTYSSVDPNGSPIDDSTSGGEQDDQLKPLINAPMASGQQGPHSVASQASGMNVIGKPIRARLGASTAPVTAPLPTAARRFARRRGSRGRGSTPGRRVSLPPLAVSQGAEDLAGAAPRLDSARHDVPPHRRWPSRKAQKISRQPAVQLGASTVRRPCVTTSLPAAVCGLARCRRSPANQQGDLWPQHSQGRHVAASTVTCEPPLHRADNPLETPGTRPSQCSSSKEPRELRGPLPCRMFLVAAILASKFLQDKCNWNCTWVELAGDLRARHLGPVRPRRRSSLRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.52
4 0.59
5 0.64
6 0.62
7 0.6
8 0.55
9 0.5
10 0.49
11 0.48
12 0.45
13 0.43
14 0.39
15 0.38
16 0.42
17 0.39
18 0.34
19 0.36
20 0.35
21 0.34
22 0.31
23 0.3
24 0.26
25 0.32
26 0.31
27 0.27
28 0.25
29 0.21
30 0.25
31 0.25
32 0.26
33 0.19
34 0.2
35 0.19
36 0.18
37 0.22
38 0.23
39 0.26
40 0.26
41 0.34
42 0.42
43 0.47
44 0.51
45 0.52
46 0.52
47 0.57
48 0.61
49 0.61
50 0.55
51 0.51
52 0.54
53 0.51
54 0.49
55 0.42
56 0.36
57 0.31
58 0.29
59 0.28
60 0.21
61 0.16
62 0.14
63 0.13
64 0.14
65 0.11
66 0.1
67 0.08
68 0.07
69 0.08
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.12
76 0.13
77 0.13
78 0.13
79 0.13
80 0.14
81 0.14
82 0.13
83 0.11
84 0.1
85 0.1
86 0.09
87 0.08
88 0.07
89 0.08
90 0.08
91 0.11
92 0.12
93 0.12
94 0.15
95 0.2
96 0.24
97 0.25
98 0.27
99 0.27
100 0.29
101 0.32
102 0.28
103 0.23
104 0.22
105 0.22
106 0.2
107 0.18
108 0.15
109 0.12
110 0.12
111 0.12
112 0.09
113 0.08
114 0.09
115 0.12
116 0.17
117 0.19
118 0.25
119 0.28
120 0.28
121 0.29
122 0.31
123 0.29
124 0.26
125 0.27
126 0.22
127 0.19
128 0.2
129 0.23
130 0.26
131 0.26
132 0.26
133 0.25
134 0.29
135 0.36
136 0.38
137 0.32
138 0.29
139 0.3
140 0.31
141 0.33
142 0.31
143 0.28
144 0.29
145 0.31
146 0.31
147 0.29
148 0.36
149 0.37
150 0.38
151 0.34
152 0.32
153 0.33
154 0.35
155 0.38
156 0.28
157 0.32
158 0.27
159 0.28
160 0.26
161 0.25
162 0.24
163 0.22
164 0.24
165 0.17
166 0.17
167 0.17
168 0.16
169 0.17
170 0.17
171 0.14
172 0.14
173 0.14
174 0.16
175 0.16
176 0.15
177 0.13
178 0.12
179 0.13
180 0.16
181 0.17
182 0.18
183 0.19
184 0.21
185 0.23
186 0.24
187 0.25
188 0.24
189 0.26
190 0.3
191 0.38
192 0.44
193 0.48
194 0.53
195 0.54
196 0.51
197 0.52
198 0.49
199 0.47
200 0.45
201 0.45
202 0.4
203 0.39
204 0.39
205 0.33
206 0.3
207 0.22
208 0.16
209 0.1
210 0.09
211 0.11
212 0.1
213 0.1
214 0.08
215 0.09
216 0.08
217 0.09
218 0.08
219 0.06
220 0.05
221 0.05
222 0.06
223 0.05
224 0.05
225 0.05
226 0.04
227 0.04
228 0.04
229 0.03
230 0.03
231 0.03
232 0.03
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.06
249 0.06
250 0.06
251 0.06
252 0.06
253 0.08
254 0.09
255 0.09
256 0.09
257 0.09
258 0.09
259 0.09
260 0.09
261 0.07
262 0.1
263 0.1
264 0.1
265 0.1
266 0.1
267 0.1
268 0.12
269 0.13
270 0.1
271 0.09
272 0.09
273 0.12
274 0.12
275 0.12
276 0.11
277 0.1
278 0.11
279 0.11
280 0.11
281 0.09
282 0.09
283 0.09
284 0.08
285 0.08
286 0.08
287 0.07
288 0.06
289 0.06
290 0.06
291 0.07
292 0.07
293 0.07
294 0.07
295 0.08
296 0.08
297 0.09
298 0.12
299 0.1
300 0.11
301 0.11
302 0.16
303 0.16
304 0.16
305 0.16
306 0.14
307 0.13
308 0.13
309 0.12
310 0.08
311 0.07
312 0.07
313 0.08
314 0.1
315 0.11
316 0.15
317 0.19
318 0.25
319 0.3
320 0.37
321 0.47
322 0.51
323 0.58
324 0.64
325 0.69
326 0.7
327 0.72
328 0.68
329 0.66
330 0.66
331 0.66
332 0.63
333 0.6
334 0.54
335 0.49
336 0.45
337 0.43
338 0.43
339 0.36
340 0.29
341 0.25
342 0.24
343 0.23
344 0.21
345 0.16
346 0.1
347 0.09
348 0.07
349 0.06
350 0.05
351 0.05
352 0.05
353 0.05
354 0.04
355 0.04
356 0.05
357 0.05
358 0.05
359 0.06
360 0.13
361 0.18
362 0.2
363 0.24
364 0.3
365 0.39
366 0.46
367 0.53
368 0.54
369 0.57
370 0.6
371 0.65
372 0.7
373 0.72
374 0.74
375 0.74
376 0.77
377 0.8
378 0.86
379 0.86
380 0.82
381 0.73
382 0.65
383 0.62
384 0.55
385 0.45
386 0.34
387 0.27
388 0.25
389 0.24
390 0.26
391 0.21
392 0.21
393 0.21
394 0.22
395 0.22
396 0.23
397 0.24
398 0.25
399 0.28
400 0.31
401 0.31
402 0.3
403 0.29
404 0.22
405 0.2
406 0.18
407 0.2
408 0.2
409 0.22
410 0.23
411 0.28
412 0.33
413 0.38
414 0.48
415 0.52
416 0.56
417 0.58
418 0.58
419 0.58
420 0.6
421 0.56
422 0.48
423 0.39
424 0.31
425 0.32
426 0.32
427 0.29
428 0.28
429 0.31
430 0.29
431 0.28
432 0.27
433 0.23
434 0.23
435 0.23
436 0.21
437 0.16
438 0.17
439 0.17
440 0.17
441 0.22
442 0.25
443 0.25
444 0.23
445 0.29
446 0.33
447 0.39
448 0.4
449 0.36
450 0.33
451 0.3
452 0.32
453 0.32
454 0.33
455 0.27
456 0.28
457 0.29
458 0.35
459 0.39
460 0.43
461 0.46
462 0.51
463 0.58
464 0.65
465 0.66
466 0.65
467 0.67
468 0.66
469 0.62
470 0.62
471 0.59
472 0.56
473 0.56
474 0.51
475 0.46
476 0.43
477 0.38
478 0.28
479 0.28
480 0.22
481 0.17
482 0.17
483 0.15
484 0.13
485 0.12
486 0.13
487 0.12
488 0.13
489 0.18
490 0.21
491 0.31
492 0.36
493 0.45
494 0.44
495 0.43
496 0.43
497 0.4
498 0.42
499 0.32
500 0.27
501 0.2
502 0.21
503 0.23
504 0.26
505 0.23
506 0.2
507 0.22
508 0.21
509 0.23
510 0.28
511 0.32
512 0.39
513 0.5
514 0.58
515 0.66
516 0.69
517 0.74