Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1R8D3

Protein Details
Accession A0A5B1R8D3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-47SQPELRSPSRRPPSRRLRRKASHPTGTHHydrophilic
NLS Segment(s)
PositionSequence
27-40PSRRPPSRRLRRKA
Subcellular Location(s) nucl 11, mito 5, cyto 5, extr 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MRTLEPSLPSIASVLAFSQSQPELRSPSRRPPSRRLRRKASHPTGTHTPRCPPQLDSDHLMKTVDYRFSSPPTLPLRSSYALPDIFESDEFEIVKSSDEGSSASSTACSARPSRSPAKARAKAKAVCSHILVRAPYRCASRTLLTSPPVPLNRILSIPCAGGCAVCVPSGGRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.12
6 0.12
7 0.14
8 0.15
9 0.18
10 0.22
11 0.27
12 0.36
13 0.38
14 0.47
15 0.56
16 0.63
17 0.68
18 0.72
19 0.78
20 0.81
21 0.87
22 0.85
23 0.85
24 0.85
25 0.89
26 0.9
27 0.88
28 0.86
29 0.78
30 0.75
31 0.75
32 0.73
33 0.68
34 0.6
35 0.56
36 0.51
37 0.53
38 0.48
39 0.4
40 0.4
41 0.4
42 0.41
43 0.4
44 0.38
45 0.35
46 0.33
47 0.31
48 0.23
49 0.2
50 0.19
51 0.18
52 0.15
53 0.17
54 0.18
55 0.21
56 0.23
57 0.21
58 0.25
59 0.26
60 0.28
61 0.25
62 0.26
63 0.27
64 0.26
65 0.27
66 0.21
67 0.2
68 0.17
69 0.17
70 0.15
71 0.12
72 0.11
73 0.11
74 0.11
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.06
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.07
88 0.08
89 0.08
90 0.07
91 0.07
92 0.07
93 0.08
94 0.09
95 0.09
96 0.11
97 0.13
98 0.17
99 0.23
100 0.29
101 0.37
102 0.41
103 0.49
104 0.58
105 0.63
106 0.64
107 0.65
108 0.66
109 0.61
110 0.62
111 0.6
112 0.53
113 0.47
114 0.46
115 0.42
116 0.38
117 0.37
118 0.32
119 0.29
120 0.29
121 0.29
122 0.29
123 0.31
124 0.29
125 0.29
126 0.32
127 0.3
128 0.31
129 0.32
130 0.34
131 0.33
132 0.33
133 0.33
134 0.36
135 0.34
136 0.32
137 0.3
138 0.3
139 0.29
140 0.29
141 0.27
142 0.23
143 0.23
144 0.22
145 0.19
146 0.16
147 0.14
148 0.12
149 0.12
150 0.11
151 0.11
152 0.1
153 0.11
154 0.11