Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1R2M0

Protein Details
Accession A0A5B1R2M0    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAQRVTLRKRQPYNTKSNRRRIVKTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTLRKRQPYNTKSNRRRIVKTPGGVLRYHHIKKLATAPKCGDCGSKLSGIPALRPREYATISKTQKSVSRAYGGSRCGTCVRSRVVRAFLVEEAKVVKKVIKSQQKAASGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.87
4 0.89
5 0.89
6 0.86
7 0.83
8 0.79
9 0.79
10 0.76
11 0.7
12 0.67
13 0.63
14 0.57
15 0.52
16 0.46
17 0.42
18 0.42
19 0.4
20 0.35
21 0.33
22 0.31
23 0.33
24 0.41
25 0.43
26 0.36
27 0.39
28 0.39
29 0.39
30 0.4
31 0.38
32 0.29
33 0.22
34 0.22
35 0.2
36 0.19
37 0.16
38 0.15
39 0.18
40 0.17
41 0.19
42 0.22
43 0.23
44 0.21
45 0.22
46 0.23
47 0.22
48 0.24
49 0.24
50 0.21
51 0.27
52 0.29
53 0.3
54 0.3
55 0.29
56 0.31
57 0.32
58 0.32
59 0.26
60 0.28
61 0.26
62 0.29
63 0.32
64 0.29
65 0.29
66 0.25
67 0.25
68 0.23
69 0.24
70 0.22
71 0.22
72 0.25
73 0.28
74 0.32
75 0.34
76 0.36
77 0.36
78 0.36
79 0.34
80 0.32
81 0.28
82 0.24
83 0.21
84 0.2
85 0.2
86 0.19
87 0.17
88 0.18
89 0.19
90 0.27
91 0.37
92 0.44
93 0.48
94 0.56
95 0.63
96 0.69