Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QBL1

Protein Details
Accession A0A5B1QBL1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-89KDALLRPYPSHRRRRPGHHLRRAPHTRSBasic
NLS Segment(s)
PositionSequence
53-103VRRPAHARPKDALLRPYPSHRRRRPGHHLRRAPHTRSQPLPLHKAHRPRGR
Subcellular Location(s) cyto 10, extr 6, nucl 5, mito 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006553  Leu-rich_rpt_Cys-con_subtyp  
IPR032675  LRR_dom_sf  
Amino Acid Sequences MHGGRPCQSHDHIAATAGPGLAVARAPIFHTSDQRYLFPLAKRHIKEVANSAVRRPAHARPKDALLRPYPSHRRRRPGHHLRRAPHTRSQPLPLHKAHRPRGRQYLQAREASPPLAAGARTGDHRRVHHGARAQLSAATLARPRGYVLPSDTIYHPANLNPNTHLECLELTDVSVCALANLSKLHRLGLVRVPNLTDEAVYTLAERCGTLRRVYLSYCVMVSVRAVHVLLQRLPKLECLALSGVPAFRSWGLRKLSRELPPYYNKLGRERSCVYTKDCIEQLRQHLTGLFNGVAWVLYGVHEHGRQSDDEELSISSDLDDECDIEDADTIDNPTTSECAESTPLLGSRFVSVSQHAPPSMGEHTAACGLTALCLHVSSATDEKGGPEKRSSWRAISRAAHKSSDGLRGLVCIFKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.27
3 0.25
4 0.18
5 0.15
6 0.1
7 0.1
8 0.09
9 0.08
10 0.07
11 0.06
12 0.07
13 0.09
14 0.12
15 0.16
16 0.18
17 0.25
18 0.3
19 0.36
20 0.38
21 0.38
22 0.38
23 0.38
24 0.4
25 0.38
26 0.4
27 0.42
28 0.49
29 0.5
30 0.52
31 0.56
32 0.53
33 0.52
34 0.51
35 0.53
36 0.52
37 0.5
38 0.48
39 0.48
40 0.45
41 0.45
42 0.43
43 0.42
44 0.44
45 0.5
46 0.53
47 0.49
48 0.58
49 0.62
50 0.63
51 0.6
52 0.55
53 0.56
54 0.53
55 0.6
56 0.62
57 0.63
58 0.69
59 0.71
60 0.76
61 0.77
62 0.84
63 0.86
64 0.86
65 0.88
66 0.88
67 0.88
68 0.83
69 0.86
70 0.85
71 0.79
72 0.76
73 0.74
74 0.7
75 0.65
76 0.67
77 0.64
78 0.62
79 0.64
80 0.61
81 0.59
82 0.58
83 0.64
84 0.65
85 0.67
86 0.68
87 0.68
88 0.73
89 0.71
90 0.73
91 0.71
92 0.73
93 0.69
94 0.66
95 0.6
96 0.52
97 0.49
98 0.4
99 0.32
100 0.21
101 0.16
102 0.13
103 0.11
104 0.09
105 0.09
106 0.09
107 0.13
108 0.16
109 0.21
110 0.24
111 0.26
112 0.32
113 0.36
114 0.37
115 0.39
116 0.41
117 0.4
118 0.39
119 0.39
120 0.32
121 0.28
122 0.26
123 0.22
124 0.17
125 0.13
126 0.11
127 0.12
128 0.12
129 0.11
130 0.12
131 0.14
132 0.14
133 0.15
134 0.16
135 0.19
136 0.19
137 0.21
138 0.21
139 0.22
140 0.21
141 0.2
142 0.18
143 0.16
144 0.21
145 0.21
146 0.22
147 0.19
148 0.21
149 0.23
150 0.23
151 0.21
152 0.16
153 0.14
154 0.14
155 0.13
156 0.1
157 0.07
158 0.07
159 0.07
160 0.06
161 0.06
162 0.04
163 0.04
164 0.04
165 0.04
166 0.05
167 0.06
168 0.07
169 0.09
170 0.1
171 0.1
172 0.12
173 0.12
174 0.14
175 0.19
176 0.24
177 0.21
178 0.22
179 0.22
180 0.2
181 0.2
182 0.17
183 0.11
184 0.06
185 0.07
186 0.07
187 0.06
188 0.07
189 0.06
190 0.06
191 0.07
192 0.06
193 0.06
194 0.09
195 0.11
196 0.11
197 0.12
198 0.14
199 0.15
200 0.16
201 0.18
202 0.16
203 0.15
204 0.14
205 0.13
206 0.1
207 0.09
208 0.09
209 0.07
210 0.06
211 0.06
212 0.06
213 0.07
214 0.1
215 0.12
216 0.15
217 0.16
218 0.17
219 0.18
220 0.19
221 0.18
222 0.17
223 0.15
224 0.12
225 0.12
226 0.12
227 0.1
228 0.1
229 0.1
230 0.09
231 0.09
232 0.09
233 0.08
234 0.07
235 0.11
236 0.12
237 0.18
238 0.22
239 0.26
240 0.29
241 0.33
242 0.39
243 0.42
244 0.45
245 0.43
246 0.45
247 0.46
248 0.49
249 0.49
250 0.46
251 0.42
252 0.44
253 0.49
254 0.45
255 0.46
256 0.45
257 0.45
258 0.46
259 0.46
260 0.43
261 0.42
262 0.41
263 0.38
264 0.37
265 0.34
266 0.33
267 0.35
268 0.37
269 0.36
270 0.34
271 0.31
272 0.3
273 0.29
274 0.26
275 0.23
276 0.17
277 0.11
278 0.11
279 0.1
280 0.08
281 0.07
282 0.06
283 0.04
284 0.04
285 0.05
286 0.06
287 0.09
288 0.1
289 0.1
290 0.12
291 0.13
292 0.13
293 0.16
294 0.2
295 0.18
296 0.17
297 0.17
298 0.16
299 0.15
300 0.15
301 0.12
302 0.07
303 0.07
304 0.07
305 0.07
306 0.07
307 0.06
308 0.07
309 0.07
310 0.07
311 0.07
312 0.07
313 0.07
314 0.07
315 0.07
316 0.08
317 0.08
318 0.08
319 0.08
320 0.08
321 0.08
322 0.08
323 0.09
324 0.08
325 0.09
326 0.12
327 0.12
328 0.12
329 0.14
330 0.15
331 0.15
332 0.16
333 0.15
334 0.15
335 0.15
336 0.15
337 0.15
338 0.15
339 0.17
340 0.2
341 0.23
342 0.21
343 0.21
344 0.2
345 0.23
346 0.23
347 0.2
348 0.17
349 0.14
350 0.16
351 0.18
352 0.17
353 0.13
354 0.12
355 0.1
356 0.1
357 0.1
358 0.1
359 0.08
360 0.08
361 0.08
362 0.08
363 0.09
364 0.12
365 0.15
366 0.15
367 0.15
368 0.15
369 0.18
370 0.26
371 0.29
372 0.29
373 0.3
374 0.36
375 0.43
376 0.5
377 0.52
378 0.52
379 0.56
380 0.57
381 0.62
382 0.63
383 0.65
384 0.66
385 0.66
386 0.6
387 0.52
388 0.53
389 0.49
390 0.5
391 0.42
392 0.34
393 0.3
394 0.3
395 0.3