Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1Q8M8

Protein Details
Accession A0A5B1Q8M8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-37SSSSGGKSAKKKKWSKGKVKDKAQHAVTHydrophilic
NLS Segment(s)
PositionSequence
10-31SSSSGGKSAKKKKWSKGKVKDK
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPPSSSSGGKSAKKKKWSKGKVKDKAQHAVTLDKPTYDRILKEVPTFRFISQSILIERLKVNGSLARVAIRHLEKEGQIKRIVHHHGQLIYTRSTASTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.49
4 0.54
5 0.58
6 0.65
7 0.72
8 0.76
9 0.8
10 0.84
11 0.86
12 0.87
13 0.9
14 0.89
15 0.91
16 0.89
17 0.84
18 0.81
19 0.72
20 0.65
21 0.55
22 0.5
23 0.42
24 0.4
25 0.34
26 0.26
27 0.25
28 0.22
29 0.24
30 0.2
31 0.18
32 0.16
33 0.2
34 0.2
35 0.24
36 0.28
37 0.25
38 0.27
39 0.28
40 0.25
41 0.24
42 0.23
43 0.22
44 0.18
45 0.18
46 0.15
47 0.18
48 0.17
49 0.16
50 0.16
51 0.14
52 0.14
53 0.12
54 0.13
55 0.11
56 0.12
57 0.12
58 0.13
59 0.13
60 0.12
61 0.13
62 0.18
63 0.17
64 0.17
65 0.18
66 0.2
67 0.21
68 0.3
69 0.33
70 0.32
71 0.35
72 0.35
73 0.36
74 0.41
75 0.45
76 0.4
77 0.41
78 0.42
79 0.39
80 0.4
81 0.42
82 0.38
83 0.33
84 0.29
85 0.26