Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QLJ7

Protein Details
Accession A0A5B1QLJ7    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
70-95SDWEWNEARKPKKRRVRRESGQHALTHydrophilic
NLS Segment(s)
PositionSequence
78-87RKPKKRRVRR
Subcellular Location(s) mito 11, nucl 8, cyto 3, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MRSVFVQLLQHAQLPFRCIDSFCASSAPRRGAGFFCVICLVPLSAEGTWPFSLAASTKLTATLCVHDVASDWEWNEARKPKKRRVRRESGQHALT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.2
5 0.17
6 0.22
7 0.25
8 0.25
9 0.23
10 0.26
11 0.23
12 0.27
13 0.31
14 0.28
15 0.24
16 0.24
17 0.25
18 0.22
19 0.24
20 0.23
21 0.18
22 0.16
23 0.15
24 0.14
25 0.12
26 0.12
27 0.09
28 0.05
29 0.06
30 0.06
31 0.05
32 0.06
33 0.06
34 0.08
35 0.08
36 0.08
37 0.08
38 0.06
39 0.07
40 0.07
41 0.09
42 0.08
43 0.09
44 0.08
45 0.1
46 0.1
47 0.11
48 0.12
49 0.11
50 0.11
51 0.11
52 0.11
53 0.1
54 0.1
55 0.13
56 0.13
57 0.13
58 0.12
59 0.14
60 0.15
61 0.16
62 0.22
63 0.27
64 0.34
65 0.43
66 0.52
67 0.59
68 0.69
69 0.79
70 0.84
71 0.87
72 0.89
73 0.9
74 0.92
75 0.92