Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VGU6

Protein Details
Accession H1VGU6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MVAFRIKDRSRKHKATPMQFYLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001242  Condensatn  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF00668  Condensation  
Amino Acid Sequences MVAFRIKDRSRKHKATPMQFYLAAYHVLLSRMTGSDDIAIGIADTNRSTMDELSAMGFFANLLPLRFGEFTSSNTFGEHLVSVKDSVREALKHSRVPYGVIHDRLGSGLPTATTGAPLFQAVFDYKQGQAESGAIGDAVMTEVIAARERTPYDVVLEMSDDPTKDPLITVKLQGSKYSPQGSRAFLNNYISLLSMFSMNPALKLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.84
4 0.8
5 0.74
6 0.67
7 0.59
8 0.51
9 0.42
10 0.33
11 0.23
12 0.17
13 0.13
14 0.13
15 0.12
16 0.1
17 0.1
18 0.1
19 0.11
20 0.1
21 0.1
22 0.09
23 0.1
24 0.09
25 0.08
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.08
36 0.08
37 0.09
38 0.08
39 0.09
40 0.09
41 0.09
42 0.08
43 0.07
44 0.06
45 0.05
46 0.05
47 0.07
48 0.06
49 0.06
50 0.07
51 0.07
52 0.1
53 0.1
54 0.1
55 0.12
56 0.12
57 0.15
58 0.19
59 0.21
60 0.19
61 0.19
62 0.19
63 0.15
64 0.15
65 0.13
66 0.08
67 0.07
68 0.07
69 0.08
70 0.09
71 0.09
72 0.08
73 0.09
74 0.1
75 0.11
76 0.14
77 0.21
78 0.24
79 0.26
80 0.27
81 0.29
82 0.28
83 0.29
84 0.26
85 0.25
86 0.25
87 0.23
88 0.23
89 0.2
90 0.2
91 0.18
92 0.17
93 0.1
94 0.06
95 0.05
96 0.04
97 0.05
98 0.05
99 0.05
100 0.06
101 0.05
102 0.05
103 0.06
104 0.06
105 0.05
106 0.04
107 0.06
108 0.06
109 0.07
110 0.08
111 0.09
112 0.1
113 0.12
114 0.12
115 0.11
116 0.11
117 0.1
118 0.09
119 0.08
120 0.07
121 0.05
122 0.04
123 0.04
124 0.03
125 0.03
126 0.03
127 0.02
128 0.02
129 0.03
130 0.04
131 0.06
132 0.06
133 0.07
134 0.09
135 0.1
136 0.13
137 0.14
138 0.14
139 0.14
140 0.16
141 0.15
142 0.13
143 0.14
144 0.12
145 0.13
146 0.13
147 0.12
148 0.11
149 0.12
150 0.12
151 0.1
152 0.1
153 0.12
154 0.15
155 0.17
156 0.19
157 0.23
158 0.28
159 0.29
160 0.31
161 0.32
162 0.32
163 0.36
164 0.41
165 0.38
166 0.38
167 0.41
168 0.42
169 0.42
170 0.42
171 0.41
172 0.37
173 0.4
174 0.34
175 0.31
176 0.28
177 0.25
178 0.2
179 0.16
180 0.12
181 0.1
182 0.09
183 0.09
184 0.14
185 0.13