Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1RFZ1

Protein Details
Accession A0A5B1RFZ1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-36RGGRDGARRGCRRRKRGAARVSRGRGBasic
NLS Segment(s)
PositionSequence
10-56ARGGRDGARRGCRRRKRGAARVSRGRGMKARQGRTGARVREHLRRLK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences AMTQDRRDSARGGRDGARRGCRRRKRGAARVSRGRGMKARQGRTGARVREHLRRLKHTGSGGVCADAPSKDVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.54
4 0.57
5 0.57
6 0.64
7 0.71
8 0.74
9 0.77
10 0.8
11 0.83
12 0.84
13 0.85
14 0.86
15 0.86
16 0.85
17 0.86
18 0.79
19 0.73
20 0.63
21 0.56
22 0.5
23 0.42
24 0.4
25 0.39
26 0.39
27 0.38
28 0.41
29 0.4
30 0.42
31 0.46
32 0.43
33 0.37
34 0.41
35 0.41
36 0.46
37 0.52
38 0.52
39 0.51
40 0.54
41 0.58
42 0.54
43 0.56
44 0.49
45 0.49
46 0.44
47 0.42
48 0.35
49 0.3
50 0.27
51 0.22
52 0.22
53 0.15
54 0.15