Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QKV9

Protein Details
Accession A0A5B1QKV9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
256-282HPSATCSSRTTRRRRRTAWRRRRAGARHydrophilic
NLS Segment(s)
PositionSequence
266-282TRRRRRTAWRRRRAGAR
Subcellular Location(s) mito 8, plas 6, mito_nucl 6, nucl 4, extr 4
Family & Domain DBs
Amino Acid Sequences MPESTVVPALVTSACVNVDVDVRLAAEPCPPNPPRRCWSPAGPSTRTTLRYCNIAICTQEWKDRCVGCVVEALVVCMSMSMSGLPASVIPSVRRVVRCSLLAALRCYHCHRRRLRARGRGPVVIVIVLRRAKKSRECAHAALPLSLSPSSSFCRPRLVVSMVSRTQNPVSRSPNPKYPASPRGITPRPSQPHLHRPAQTRPSHPPPRPPLLPTHTSTCPCPPSQSPFPPSAQRQLDPGWQTAHSSARPLRRPLRAHPSATCSSRTTRRRRRTAWRRRRAGAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.1
5 0.12
6 0.11
7 0.11
8 0.1
9 0.11
10 0.11
11 0.11
12 0.11
13 0.15
14 0.17
15 0.18
16 0.26
17 0.28
18 0.37
19 0.43
20 0.5
21 0.5
22 0.55
23 0.6
24 0.57
25 0.63
26 0.64
27 0.65
28 0.66
29 0.63
30 0.56
31 0.56
32 0.55
33 0.51
34 0.43
35 0.41
36 0.35
37 0.36
38 0.35
39 0.35
40 0.32
41 0.3
42 0.29
43 0.25
44 0.29
45 0.27
46 0.32
47 0.29
48 0.28
49 0.31
50 0.3
51 0.3
52 0.28
53 0.26
54 0.21
55 0.23
56 0.21
57 0.17
58 0.16
59 0.16
60 0.12
61 0.11
62 0.1
63 0.07
64 0.06
65 0.04
66 0.04
67 0.03
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.06
74 0.07
75 0.08
76 0.08
77 0.11
78 0.13
79 0.17
80 0.18
81 0.2
82 0.22
83 0.24
84 0.24
85 0.23
86 0.24
87 0.24
88 0.24
89 0.23
90 0.23
91 0.21
92 0.23
93 0.27
94 0.34
95 0.37
96 0.43
97 0.48
98 0.56
99 0.65
100 0.73
101 0.77
102 0.77
103 0.78
104 0.79
105 0.76
106 0.67
107 0.58
108 0.49
109 0.39
110 0.29
111 0.22
112 0.13
113 0.13
114 0.14
115 0.15
116 0.15
117 0.17
118 0.21
119 0.26
120 0.35
121 0.39
122 0.42
123 0.46
124 0.46
125 0.47
126 0.47
127 0.42
128 0.34
129 0.26
130 0.2
131 0.16
132 0.14
133 0.11
134 0.07
135 0.09
136 0.1
137 0.14
138 0.16
139 0.16
140 0.21
141 0.21
142 0.22
143 0.25
144 0.26
145 0.27
146 0.26
147 0.32
148 0.29
149 0.29
150 0.28
151 0.26
152 0.25
153 0.25
154 0.26
155 0.26
156 0.3
157 0.37
158 0.44
159 0.46
160 0.51
161 0.5
162 0.5
163 0.48
164 0.49
165 0.49
166 0.46
167 0.44
168 0.39
169 0.45
170 0.47
171 0.46
172 0.43
173 0.45
174 0.45
175 0.47
176 0.51
177 0.49
178 0.55
179 0.59
180 0.61
181 0.57
182 0.58
183 0.64
184 0.66
185 0.64
186 0.59
187 0.6
188 0.64
189 0.68
190 0.66
191 0.66
192 0.64
193 0.67
194 0.65
195 0.59
196 0.57
197 0.53
198 0.55
199 0.48
200 0.46
201 0.43
202 0.42
203 0.43
204 0.4
205 0.38
206 0.34
207 0.36
208 0.34
209 0.38
210 0.45
211 0.5
212 0.48
213 0.48
214 0.51
215 0.53
216 0.53
217 0.54
218 0.5
219 0.43
220 0.43
221 0.42
222 0.45
223 0.4
224 0.38
225 0.32
226 0.27
227 0.29
228 0.28
229 0.3
230 0.23
231 0.27
232 0.3
233 0.37
234 0.43
235 0.49
236 0.54
237 0.58
238 0.63
239 0.66
240 0.71
241 0.69
242 0.67
243 0.64
244 0.63
245 0.61
246 0.59
247 0.54
248 0.46
249 0.46
250 0.51
251 0.56
252 0.6
253 0.65
254 0.72
255 0.79
256 0.85
257 0.89
258 0.91
259 0.93
260 0.93
261 0.93
262 0.91