Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QA93

Protein Details
Accession A0A5B1QA93    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-103EEWEEKQRRKKEKAEKAKAEKEABasic
160-184LFAMRLNEHRKQRQSKQMRELAPKLHydrophilic
NLS Segment(s)
PositionSequence
85-129EKQRRKKEKAEKAKAEKEAAAKDGEKKDEDKESAGKDKKSKSPSP
Subcellular Location(s) mito 17, mito_nucl 12.499, cyto_mito 10.999, nucl 6.5, cyto_nucl 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSFTNLYYKRTAGTPKACYVCYKPTPTVLATANAVDFIYTCDAHLKDPGFATQLGDSGDGVSPGGAKKMGLSPEEIAKVKEEWEEKQRRKKEKAEKAKAEKEAAAKDGEKKDEDKESAGKDKKSKSPSPMPKTPGSLPASPSGSGTPTPSHDRYALHRDLFAMRLNEHRKQRQSKQMRELAPKLPGAPRGLPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.52
4 0.52
5 0.51
6 0.49
7 0.5
8 0.49
9 0.5
10 0.44
11 0.45
12 0.47
13 0.43
14 0.42
15 0.35
16 0.3
17 0.25
18 0.23
19 0.19
20 0.16
21 0.15
22 0.1
23 0.08
24 0.08
25 0.09
26 0.09
27 0.09
28 0.13
29 0.14
30 0.15
31 0.19
32 0.18
33 0.17
34 0.17
35 0.18
36 0.16
37 0.16
38 0.16
39 0.12
40 0.13
41 0.12
42 0.11
43 0.1
44 0.09
45 0.09
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.06
55 0.1
56 0.12
57 0.12
58 0.14
59 0.14
60 0.17
61 0.2
62 0.19
63 0.16
64 0.15
65 0.15
66 0.14
67 0.16
68 0.16
69 0.15
70 0.25
71 0.34
72 0.4
73 0.49
74 0.57
75 0.62
76 0.67
77 0.73
78 0.74
79 0.75
80 0.8
81 0.8
82 0.81
83 0.81
84 0.81
85 0.74
86 0.65
87 0.56
88 0.48
89 0.39
90 0.31
91 0.24
92 0.19
93 0.21
94 0.22
95 0.22
96 0.2
97 0.2
98 0.21
99 0.24
100 0.24
101 0.21
102 0.22
103 0.23
104 0.31
105 0.33
106 0.35
107 0.36
108 0.41
109 0.46
110 0.5
111 0.52
112 0.51
113 0.57
114 0.64
115 0.67
116 0.69
117 0.66
118 0.62
119 0.62
120 0.56
121 0.53
122 0.47
123 0.41
124 0.36
125 0.35
126 0.34
127 0.3
128 0.29
129 0.21
130 0.19
131 0.17
132 0.17
133 0.15
134 0.17
135 0.23
136 0.24
137 0.26
138 0.26
139 0.28
140 0.32
141 0.38
142 0.4
143 0.34
144 0.33
145 0.32
146 0.32
147 0.32
148 0.3
149 0.24
150 0.2
151 0.28
152 0.34
153 0.39
154 0.46
155 0.53
156 0.59
157 0.66
158 0.74
159 0.76
160 0.81
161 0.84
162 0.85
163 0.84
164 0.83
165 0.82
166 0.78
167 0.72
168 0.67
169 0.58
170 0.52
171 0.47
172 0.44
173 0.4
174 0.38