Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QQ40

Protein Details
Accession A0A5B1QQ40    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-43VITAVRRGRARPRRACRAAPPTRLDTRRPNKIQKRAWRLPNLHydrophilic
NLS Segment(s)
PositionSequence
7-36RRGRARPRRACRAAPPTRLDTRRPNKIQKR
Subcellular Location(s) mito 15, cyto 7.5, cyto_nucl 6.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MVITAVRRGRARPRRACRAAPPTRLDTRRPNKIQKRAWRLPNLATTSVPFGVTYEKIGTIQRRLAWPLHKDDTLSQSGRPTGLNIYFLLHLSRTVHTLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.82
4 0.81
5 0.81
6 0.8
7 0.76
8 0.72
9 0.67
10 0.69
11 0.66
12 0.62
13 0.62
14 0.61
15 0.64
16 0.66
17 0.71
18 0.72
19 0.78
20 0.82
21 0.81
22 0.83
23 0.81
24 0.82
25 0.79
26 0.72
27 0.66
28 0.63
29 0.56
30 0.47
31 0.39
32 0.31
33 0.26
34 0.23
35 0.19
36 0.12
37 0.09
38 0.09
39 0.09
40 0.09
41 0.08
42 0.08
43 0.09
44 0.11
45 0.13
46 0.14
47 0.17
48 0.18
49 0.19
50 0.21
51 0.24
52 0.28
53 0.29
54 0.33
55 0.34
56 0.33
57 0.32
58 0.33
59 0.34
60 0.33
61 0.31
62 0.25
63 0.24
64 0.24
65 0.24
66 0.22
67 0.18
68 0.18
69 0.18
70 0.19
71 0.16
72 0.18
73 0.17
74 0.18
75 0.18
76 0.13
77 0.14
78 0.15
79 0.15
80 0.17