Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QDH1

Protein Details
Accession A0A5B1QDH1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-101AFKPSPTKRPQGTRERRGKKRSAESGACHydrophilic
NLS Segment(s)
PositionSequence
76-95KPSPTKRPQGTRERRGKKRS
Subcellular Location(s) nucl 12, mito 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MTWINDFEKNFQAHAVNNRHKCLSCGTCFADAAGLKDHLAQATHFRCNVCSRGFGSSRALCQHLFDSPKHRLLAFKPSPTKRPQGTRERRGKKRSAESGAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.44
4 0.47
5 0.5
6 0.51
7 0.49
8 0.47
9 0.45
10 0.42
11 0.35
12 0.36
13 0.35
14 0.34
15 0.33
16 0.32
17 0.27
18 0.21
19 0.19
20 0.16
21 0.14
22 0.12
23 0.12
24 0.13
25 0.09
26 0.1
27 0.08
28 0.14
29 0.16
30 0.18
31 0.19
32 0.18
33 0.2
34 0.22
35 0.25
36 0.19
37 0.18
38 0.17
39 0.21
40 0.22
41 0.22
42 0.24
43 0.22
44 0.23
45 0.23
46 0.23
47 0.18
48 0.19
49 0.18
50 0.17
51 0.19
52 0.18
53 0.23
54 0.26
55 0.3
56 0.3
57 0.29
58 0.28
59 0.29
60 0.38
61 0.37
62 0.41
63 0.46
64 0.5
65 0.56
66 0.58
67 0.64
68 0.6
69 0.64
70 0.65
71 0.67
72 0.74
73 0.78
74 0.84
75 0.86
76 0.88
77 0.88
78 0.87
79 0.86
80 0.86
81 0.85