FuNGI

A0A5B1RB87

Protein Details

Accession

A0A5B1RB87

Localization Confidence

High

Confidence Score

17.5

NoLS Segment(s)

Position	Sequence	Protein Nature
35-64	VKGARNRRDGARTARRRKKVPRPSFYTHSS	Hydrophilic
359-378	RPATCTRTHCRLRPHRPSSP	Hydrophilic

NLS Segment(s)

Position	Sequence
27-57	ARMRRGAGVKGARNRRDGARTARRRKKVPRP
191-218	RPSRVRHARRPPVTPLAPSRRSRPSRHR

Subcellular Location(s)

nucl 21, cyto_nucl 13.5, cyto 4

Family & Domain DBs

Amino Acid Sequences

MQRRETSTKSTCRHNKESTTARGGADARMRRGAGVKGARNRRDGARTARRRKKVPRPSFYTHSSSLAPSSRRRARAPLTFAPSSSRAVSTPACPSRPSRPSPPFGAIWLVSRRSRILTVPSSLRAPRCVMPVGPSAFASLAPSRSSSCFGPSSRPSILPSPRRAVAPLARPSHTSRCRTCRAPVAPIVPSRPSRVRHARRPPVTPLAPSRRSRPSRHRARCAIATSAPRGVPQLPPLPPPPPFAYRLPPPFAYRLPPPFAYRLPPPFTYRLPPPLIPPAACVCAPRRYAHYHVPLPLPPPSPTARFSAPRRRSSYRLHVCAPPLQALPRPLVAPPPPLDSAPLPAHGAAARLQVGDEWRPATCTRTHCRLRPHRPSSPATPASPPLHAPPPAAAACQCCYCTHSLSRAHTTYYRPLRRALTSLVRAPHSYTTPTLPLAARLAPTIRSCAPSSTSAPRWFAYQRQA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.76
2	0.75
3	0.74
4	0.79
5	0.76
6	0.74
7	0.68
8	0.59
9	0.55
10	0.49
11	0.45
12	0.44
13	0.41
14	0.38
15	0.39
16	0.39
17	0.35
18	0.38
19	0.35
20	0.36
21	0.39
22	0.43
23	0.48
24	0.58
25	0.62
26	0.62
27	0.64
28	0.62
29	0.6
30	0.59
31	0.6
32	0.62
33	0.68
34	0.75
35	0.81
36	0.82
37	0.85
38	0.89
39	0.89
40	0.89
41	0.89
42	0.89
43	0.87
44	0.87
45	0.84
46	0.79
47	0.75
48	0.66
49	0.58
50	0.49
51	0.42
52	0.38
53	0.37
54	0.35
55	0.34
56	0.42
57	0.47
58	0.51
59	0.53
60	0.57
61	0.59
62	0.63
63	0.66
64	0.64
65	0.63
66	0.58
67	0.56
68	0.52
69	0.46
70	0.4
71	0.33
72	0.26
73	0.19
74	0.22
75	0.23
76	0.22
77	0.29
78	0.31
79	0.31
80	0.32
81	0.36
82	0.42
83	0.48
84	0.51
85	0.52
86	0.54
87	0.58
88	0.61
89	0.61
90	0.52
91	0.46
92	0.43
93	0.34
94	0.31
95	0.3
96	0.29
97	0.26
98	0.27
99	0.27
100	0.25
101	0.27
102	0.24
103	0.27
104	0.26
105	0.3
106	0.31
107	0.32
108	0.33
109	0.35
110	0.34
111	0.3
112	0.29
113	0.27
114	0.27
115	0.27
116	0.24
117	0.24
118	0.28
119	0.27
120	0.25
121	0.22
122	0.2
123	0.18
124	0.18
125	0.17
126	0.12
127	0.12
128	0.12
129	0.13
130	0.13
131	0.15
132	0.17
133	0.15
134	0.17
135	0.2
136	0.2
137	0.26
138	0.27
139	0.31
140	0.31
141	0.31
142	0.3
143	0.34
144	0.41
145	0.42
146	0.44
147	0.43
148	0.43
149	0.42
150	0.41
151	0.38
152	0.36
153	0.36
154	0.39
155	0.38
156	0.37
157	0.39
158	0.43
159	0.48
160	0.49
161	0.48
162	0.47
163	0.5
164	0.55
165	0.56
166	0.55
167	0.54
168	0.51
169	0.49
170	0.46
171	0.43
172	0.41
173	0.39
174	0.38
175	0.32
176	0.3
177	0.3
178	0.31
179	0.31
180	0.36
181	0.45
182	0.51
183	0.57
184	0.67
185	0.72
186	0.71
187	0.73
188	0.7
189	0.67
190	0.6
191	0.53
192	0.5
193	0.49
194	0.51
195	0.49
196	0.49
197	0.5
198	0.54
199	0.58
200	0.61
201	0.63
202	0.67
203	0.74
204	0.78
205	0.73
206	0.72
207	0.7
208	0.62
209	0.54
210	0.47
211	0.4
212	0.33
213	0.3
214	0.25
215	0.2
216	0.19
217	0.17
218	0.14
219	0.15
220	0.18
221	0.17
222	0.19
223	0.21
224	0.22
225	0.22
226	0.25
227	0.25
228	0.23
229	0.25
230	0.25
231	0.28
232	0.31
233	0.34
234	0.34
235	0.32
236	0.32
237	0.31
238	0.3
239	0.29
240	0.27
241	0.27
242	0.27
243	0.27
244	0.27
245	0.27
246	0.27
247	0.27
248	0.27
249	0.29
250	0.3
251	0.3
252	0.32
253	0.33
254	0.33
255	0.34
256	0.33
257	0.33
258	0.32
259	0.31
260	0.3
261	0.33
262	0.33
263	0.29
264	0.28
265	0.23
266	0.22
267	0.22
268	0.2
269	0.17
270	0.22
271	0.23
272	0.23
273	0.25
274	0.28
275	0.33
276	0.39
277	0.43
278	0.4
279	0.42
280	0.43
281	0.4
282	0.37
283	0.37
284	0.31
285	0.25
286	0.25
287	0.25
288	0.25
289	0.26
290	0.27
291	0.27
292	0.31
293	0.38
294	0.46
295	0.51
296	0.56
297	0.62
298	0.63
299	0.64
300	0.66
301	0.7
302	0.68
303	0.65
304	0.6
305	0.56
306	0.54
307	0.53
308	0.46
309	0.38
310	0.3
311	0.27
312	0.26
313	0.24
314	0.24
315	0.2
316	0.19
317	0.17
318	0.21
319	0.2
320	0.22
321	0.22
322	0.25
323	0.24
324	0.24
325	0.26
326	0.21
327	0.25
328	0.22
329	0.21
330	0.18
331	0.16
332	0.17
333	0.15
334	0.16
335	0.12
336	0.12
337	0.11
338	0.1
339	0.1
340	0.11
341	0.13
342	0.14
343	0.14
344	0.13
345	0.13
346	0.16
347	0.16
348	0.18
349	0.21
350	0.27
351	0.32
352	0.41
353	0.48
354	0.51
355	0.61
356	0.69
357	0.75
358	0.78
359	0.8
360	0.78
361	0.79
362	0.79
363	0.75
364	0.74
365	0.68
366	0.6
367	0.55
368	0.53
369	0.48
370	0.44
371	0.39
372	0.33
373	0.34
374	0.33
375	0.3
376	0.25
377	0.28
378	0.27
379	0.26
380	0.23
381	0.21
382	0.22
383	0.23
384	0.23
385	0.18
386	0.2
387	0.21
388	0.24
389	0.25
390	0.3
391	0.35
392	0.4
393	0.48
394	0.47
395	0.48
396	0.48
397	0.48
398	0.51
399	0.55
400	0.57
401	0.51
402	0.55
403	0.56
404	0.55
405	0.55
406	0.52
407	0.5
408	0.48
409	0.51
410	0.51
411	0.48
412	0.45
413	0.45
414	0.42
415	0.36
416	0.33
417	0.3
418	0.3
419	0.3
420	0.3
421	0.3
422	0.26
423	0.26
424	0.25
425	0.25
426	0.21
427	0.21
428	0.21
429	0.22
430	0.23
431	0.26
432	0.26
433	0.28
434	0.28
435	0.3
436	0.31
437	0.32
438	0.36
439	0.39
440	0.44
441	0.46
442	0.48
443	0.45
444	0.47
445	0.46

A0A5B1RB87

3D AlphaFold-predicted Structure Viewer