Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QYM9

Protein Details
Accession A0A5B1QYM9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
37-68STPPRQIDSRYKKNKIRRVKKCSPKAVQYHESHydrophilic
NLS Segment(s)
PositionSequence
49-55KNKIRRV
Subcellular Location(s) mito 16, nucl 9, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MAVDVHHSPHLHSFAYTFISISSYLYTSYMRATSCSSTPPRQIDSRYKKNKIRRVKKCSPKAVQYHES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.18
4 0.13
5 0.11
6 0.11
7 0.11
8 0.11
9 0.1
10 0.08
11 0.08
12 0.09
13 0.09
14 0.08
15 0.09
16 0.1
17 0.09
18 0.1
19 0.11
20 0.12
21 0.12
22 0.16
23 0.2
24 0.22
25 0.27
26 0.28
27 0.3
28 0.32
29 0.37
30 0.43
31 0.49
32 0.56
33 0.61
34 0.67
35 0.72
36 0.79
37 0.83
38 0.84
39 0.85
40 0.85
41 0.85
42 0.88
43 0.9
44 0.91
45 0.92
46 0.89
47 0.87
48 0.86