Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1RG94

Protein Details
Accession A0A5B1RG94    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
239-262VSCPRCVPSRRSPRHRRHSPYALSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MPSFCMPSPPPRAFVQLSHPFASPSRRFASPSHLPVAPLAPSCAVLVPGRAVLAPSRVAVTQLSSYMPLRAVSCRPSRRVLPPFAPVCAGAAPLCAISRRFAHLSHPVVSSRAPSRHHRTAVVPVHALSPSAPSSRPCAPLVPSLPPSCRLTASRNPSHPSTPPLRLLTPRTRAPSRAPSCCPRAPSHAVVAPPVAPSSRPVVAPPRTPPLCPSAPFRALHTAVAPSSSCPSHVLLVPVSCPRCVPSRRSPRHRRHSPYALSHQHGGFVPSCRHFTHSSPCWPLARPHALTRPAAPFPSPIGRLSSHPIVCTPLTAVFALRRAVMGSPRAPSLLRVPRSALFAPHGAAPHPVCRLAPCPAVCTPRPAVSLPTAPSLAPRPLFARPSLPSSRSVTRSQFRPAIFARHCALSVPVPPFPWPVGCVVPHPAVVAWCHAPSRGVTRSQHLAPPSHTFALPLRAPTAPFRPMAPPLAPHTFVRHPTPPSCTPSARLPSRRTPTPVCPAVTHPNGAVMPQRHLRTPSHAIALPPGGLARRRLLRRLAALAHAHAHTRWNQMDGRGGVAGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.46
4 0.48
5 0.47
6 0.45
7 0.41
8 0.41
9 0.48
10 0.41
11 0.38
12 0.37
13 0.37
14 0.4
15 0.4
16 0.46
17 0.46
18 0.48
19 0.46
20 0.42
21 0.41
22 0.39
23 0.4
24 0.34
25 0.25
26 0.22
27 0.17
28 0.17
29 0.17
30 0.16
31 0.15
32 0.13
33 0.13
34 0.12
35 0.12
36 0.12
37 0.11
38 0.12
39 0.11
40 0.14
41 0.13
42 0.13
43 0.14
44 0.14
45 0.15
46 0.14
47 0.15
48 0.14
49 0.14
50 0.15
51 0.15
52 0.16
53 0.17
54 0.17
55 0.16
56 0.16
57 0.19
58 0.22
59 0.27
60 0.36
61 0.41
62 0.45
63 0.49
64 0.54
65 0.59
66 0.64
67 0.64
68 0.59
69 0.61
70 0.59
71 0.54
72 0.49
73 0.39
74 0.33
75 0.25
76 0.21
77 0.12
78 0.11
79 0.1
80 0.09
81 0.09
82 0.1
83 0.1
84 0.12
85 0.14
86 0.19
87 0.2
88 0.2
89 0.25
90 0.32
91 0.35
92 0.36
93 0.36
94 0.32
95 0.32
96 0.31
97 0.3
98 0.28
99 0.3
100 0.31
101 0.37
102 0.46
103 0.53
104 0.55
105 0.54
106 0.51
107 0.55
108 0.58
109 0.53
110 0.45
111 0.37
112 0.35
113 0.32
114 0.29
115 0.19
116 0.15
117 0.14
118 0.14
119 0.15
120 0.15
121 0.19
122 0.24
123 0.27
124 0.26
125 0.26
126 0.27
127 0.33
128 0.34
129 0.35
130 0.34
131 0.34
132 0.35
133 0.35
134 0.35
135 0.3
136 0.3
137 0.27
138 0.3
139 0.35
140 0.43
141 0.47
142 0.49
143 0.52
144 0.52
145 0.53
146 0.48
147 0.45
148 0.43
149 0.4
150 0.4
151 0.39
152 0.39
153 0.39
154 0.44
155 0.47
156 0.47
157 0.47
158 0.48
159 0.48
160 0.48
161 0.5
162 0.54
163 0.52
164 0.53
165 0.53
166 0.53
167 0.57
168 0.57
169 0.55
170 0.47
171 0.48
172 0.47
173 0.44
174 0.42
175 0.38
176 0.35
177 0.32
178 0.29
179 0.22
180 0.17
181 0.15
182 0.11
183 0.08
184 0.09
185 0.12
186 0.13
187 0.12
188 0.14
189 0.22
190 0.25
191 0.29
192 0.3
193 0.36
194 0.35
195 0.36
196 0.35
197 0.34
198 0.33
199 0.31
200 0.33
201 0.31
202 0.35
203 0.35
204 0.35
205 0.35
206 0.32
207 0.31
208 0.27
209 0.21
210 0.17
211 0.17
212 0.15
213 0.1
214 0.11
215 0.1
216 0.1
217 0.1
218 0.11
219 0.11
220 0.12
221 0.13
222 0.12
223 0.12
224 0.13
225 0.16
226 0.16
227 0.14
228 0.13
229 0.14
230 0.2
231 0.23
232 0.28
233 0.34
234 0.45
235 0.55
236 0.66
237 0.75
238 0.78
239 0.86
240 0.9
241 0.87
242 0.85
243 0.84
244 0.8
245 0.76
246 0.74
247 0.68
248 0.6
249 0.54
250 0.45
251 0.37
252 0.31
253 0.26
254 0.18
255 0.16
256 0.16
257 0.16
258 0.18
259 0.17
260 0.2
261 0.2
262 0.21
263 0.27
264 0.29
265 0.34
266 0.34
267 0.36
268 0.34
269 0.33
270 0.33
271 0.31
272 0.32
273 0.28
274 0.28
275 0.32
276 0.34
277 0.33
278 0.34
279 0.31
280 0.26
281 0.25
282 0.22
283 0.17
284 0.16
285 0.19
286 0.18
287 0.15
288 0.16
289 0.17
290 0.18
291 0.21
292 0.25
293 0.21
294 0.2
295 0.2
296 0.2
297 0.19
298 0.17
299 0.14
300 0.09
301 0.1
302 0.1
303 0.1
304 0.08
305 0.1
306 0.1
307 0.09
308 0.08
309 0.08
310 0.09
311 0.1
312 0.13
313 0.13
314 0.14
315 0.14
316 0.15
317 0.14
318 0.15
319 0.21
320 0.26
321 0.26
322 0.26
323 0.28
324 0.29
325 0.33
326 0.32
327 0.25
328 0.19
329 0.18
330 0.17
331 0.17
332 0.16
333 0.12
334 0.14
335 0.14
336 0.14
337 0.15
338 0.14
339 0.13
340 0.14
341 0.17
342 0.17
343 0.22
344 0.19
345 0.22
346 0.25
347 0.3
348 0.28
349 0.31
350 0.29
351 0.28
352 0.3
353 0.27
354 0.26
355 0.24
356 0.27
357 0.24
358 0.24
359 0.21
360 0.18
361 0.19
362 0.2
363 0.2
364 0.17
365 0.16
366 0.17
367 0.2
368 0.22
369 0.22
370 0.24
371 0.22
372 0.29
373 0.32
374 0.31
375 0.31
376 0.34
377 0.39
378 0.38
379 0.41
380 0.41
381 0.42
382 0.44
383 0.46
384 0.47
385 0.42
386 0.43
387 0.4
388 0.43
389 0.38
390 0.39
391 0.35
392 0.3
393 0.3
394 0.25
395 0.25
396 0.18
397 0.21
398 0.2
399 0.2
400 0.19
401 0.2
402 0.22
403 0.21
404 0.19
405 0.16
406 0.15
407 0.16
408 0.16
409 0.17
410 0.2
411 0.2
412 0.19
413 0.18
414 0.16
415 0.14
416 0.14
417 0.15
418 0.13
419 0.13
420 0.13
421 0.13
422 0.14
423 0.14
424 0.2
425 0.21
426 0.26
427 0.27
428 0.31
429 0.36
430 0.38
431 0.4
432 0.36
433 0.36
434 0.33
435 0.37
436 0.37
437 0.33
438 0.31
439 0.28
440 0.27
441 0.31
442 0.29
443 0.24
444 0.22
445 0.21
446 0.23
447 0.26
448 0.29
449 0.25
450 0.25
451 0.25
452 0.27
453 0.29
454 0.32
455 0.29
456 0.27
457 0.3
458 0.35
459 0.35
460 0.32
461 0.35
462 0.36
463 0.38
464 0.41
465 0.42
466 0.41
467 0.43
468 0.49
469 0.49
470 0.5
471 0.52
472 0.48
473 0.45
474 0.49
475 0.55
476 0.57
477 0.59
478 0.59
479 0.63
480 0.69
481 0.72
482 0.69
483 0.67
484 0.66
485 0.67
486 0.66
487 0.59
488 0.54
489 0.53
490 0.56
491 0.52
492 0.46
493 0.36
494 0.35
495 0.32
496 0.31
497 0.32
498 0.25
499 0.28
500 0.33
501 0.36
502 0.35
503 0.39
504 0.4
505 0.41
506 0.47
507 0.44
508 0.43
509 0.43
510 0.4
511 0.41
512 0.39
513 0.31
514 0.24
515 0.21
516 0.19
517 0.2
518 0.22
519 0.25
520 0.32
521 0.37
522 0.42
523 0.47
524 0.51
525 0.54
526 0.58
527 0.54
528 0.51
529 0.5
530 0.46
531 0.44
532 0.38
533 0.34
534 0.28
535 0.3
536 0.28
537 0.33
538 0.32
539 0.32
540 0.34
541 0.35
542 0.43
543 0.38
544 0.36
545 0.31