Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QFA8

Protein Details
Accession A0A5B1QFA8    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-57STGCWTPWSKSRRRREQALREYWYTHydrophilic
163-194EDPYLPRHRSHRSRRSRRRRDRRYQSPTTTSABasic
NLS Segment(s)
PositionSequence
169-185RHRSHRSRRSRRRRDRR
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MGSSSSKHSPIFQNIQPTTVYPPYPTYEEYLPSTGCWTPWSKSRRRREQALREYWYTTPILYQFPAGTFPPGMLYAPAAAGQPVTGIPANVAVMAAQAQAASETPASTAQSNNEMLQAEPNTQMPEPMTGMPVPSTQIHAPEPQPAVAPPVIPDFGLATGYQEDPYLPRHRSHRSRRSRRRRDRRYQSPTTTSASDSEDSVEDDRYASPSSDSYSSDPYSSSRSYSQRSRYERNPLPEPPEDVLQRTPYRHLLPNLRSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.44
4 0.39
5 0.37
6 0.34
7 0.31
8 0.23
9 0.26
10 0.28
11 0.3
12 0.3
13 0.28
14 0.26
15 0.28
16 0.29
17 0.28
18 0.25
19 0.22
20 0.24
21 0.21
22 0.19
23 0.19
24 0.19
25 0.19
26 0.27
27 0.35
28 0.41
29 0.51
30 0.61
31 0.7
32 0.74
33 0.82
34 0.85
35 0.88
36 0.88
37 0.88
38 0.83
39 0.74
40 0.69
41 0.59
42 0.51
43 0.4
44 0.29
45 0.22
46 0.18
47 0.17
48 0.14
49 0.15
50 0.13
51 0.13
52 0.15
53 0.14
54 0.14
55 0.11
56 0.11
57 0.11
58 0.11
59 0.11
60 0.08
61 0.08
62 0.07
63 0.07
64 0.08
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.04
71 0.06
72 0.05
73 0.05
74 0.05
75 0.06
76 0.06
77 0.06
78 0.06
79 0.04
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.06
93 0.07
94 0.07
95 0.08
96 0.08
97 0.11
98 0.12
99 0.12
100 0.12
101 0.12
102 0.11
103 0.13
104 0.12
105 0.11
106 0.11
107 0.11
108 0.11
109 0.11
110 0.11
111 0.09
112 0.09
113 0.09
114 0.09
115 0.09
116 0.07
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.09
123 0.09
124 0.11
125 0.12
126 0.14
127 0.14
128 0.17
129 0.17
130 0.15
131 0.15
132 0.14
133 0.15
134 0.13
135 0.12
136 0.09
137 0.1
138 0.1
139 0.09
140 0.09
141 0.07
142 0.07
143 0.08
144 0.07
145 0.06
146 0.07
147 0.08
148 0.08
149 0.07
150 0.07
151 0.07
152 0.12
153 0.17
154 0.17
155 0.2
156 0.26
157 0.36
158 0.46
159 0.56
160 0.62
161 0.68
162 0.78
163 0.86
164 0.92
165 0.94
166 0.95
167 0.96
168 0.96
169 0.96
170 0.96
171 0.96
172 0.94
173 0.92
174 0.88
175 0.82
176 0.75
177 0.67
178 0.57
179 0.47
180 0.4
181 0.33
182 0.26
183 0.2
184 0.18
185 0.15
186 0.15
187 0.15
188 0.14
189 0.11
190 0.11
191 0.11
192 0.12
193 0.13
194 0.11
195 0.11
196 0.11
197 0.14
198 0.15
199 0.17
200 0.18
201 0.22
202 0.22
203 0.22
204 0.22
205 0.2
206 0.24
207 0.23
208 0.23
209 0.25
210 0.29
211 0.35
212 0.43
213 0.51
214 0.55
215 0.62
216 0.67
217 0.68
218 0.73
219 0.74
220 0.74
221 0.71
222 0.67
223 0.66
224 0.62
225 0.59
226 0.51
227 0.5
228 0.44
229 0.41
230 0.39
231 0.4
232 0.4
233 0.38
234 0.4
235 0.4
236 0.44
237 0.47
238 0.51
239 0.54