Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QH08

Protein Details
Accession A0A5B1QH08    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
199-240ATPPWLPPALARRRRRRRCCCGPCRRLTPSRRRHMHPCAPTPHydrophilic
NLS Segment(s)
PositionSequence
210-215RRRRRR
Subcellular Location(s) mito 14, nucl 9, extr 2
Family & Domain DBs
Amino Acid Sequences MRRRTAVTCSLAPSCCRTAPLSRARRYLPPSRCHRAPSHKDATRPRDAVSRLRNHASRLRDTPINAAVRPVCPVSRMCAPYLVRSRRLAPTNTVSTASRPCDAAPRPNDVAPHRRATAPRRSNTLEALWHPFDDISHSLDAAPCPSAAVPRTCIAISRPCMRSPLAPPLRSHAAAALVHMHAAPPQPCHAPASPSRTPATPPWLPPALARRRRRRRCCCGPCRRLTPSRRRHMHPCAPTPSLRAPPALFRGHDPPPPSLPAHAPASPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.32
4 0.31
5 0.33
6 0.4
7 0.48
8 0.53
9 0.56
10 0.61
11 0.62
12 0.66
13 0.66
14 0.67
15 0.66
16 0.65
17 0.67
18 0.7
19 0.71
20 0.68
21 0.71
22 0.72
23 0.72
24 0.72
25 0.74
26 0.69
27 0.73
28 0.78
29 0.76
30 0.74
31 0.66
32 0.59
33 0.56
34 0.55
35 0.56
36 0.55
37 0.56
38 0.52
39 0.57
40 0.57
41 0.54
42 0.57
43 0.54
44 0.51
45 0.46
46 0.46
47 0.43
48 0.42
49 0.42
50 0.42
51 0.39
52 0.33
53 0.32
54 0.28
55 0.25
56 0.26
57 0.23
58 0.17
59 0.15
60 0.16
61 0.17
62 0.23
63 0.24
64 0.23
65 0.27
66 0.28
67 0.34
68 0.43
69 0.44
70 0.41
71 0.41
72 0.44
73 0.45
74 0.48
75 0.42
76 0.38
77 0.39
78 0.39
79 0.38
80 0.36
81 0.3
82 0.28
83 0.3
84 0.27
85 0.21
86 0.18
87 0.17
88 0.22
89 0.24
90 0.3
91 0.28
92 0.32
93 0.33
94 0.34
95 0.37
96 0.34
97 0.39
98 0.35
99 0.36
100 0.31
101 0.32
102 0.35
103 0.38
104 0.45
105 0.45
106 0.44
107 0.46
108 0.47
109 0.46
110 0.44
111 0.39
112 0.31
113 0.24
114 0.27
115 0.22
116 0.19
117 0.17
118 0.15
119 0.13
120 0.13
121 0.13
122 0.09
123 0.09
124 0.09
125 0.09
126 0.1
127 0.1
128 0.08
129 0.07
130 0.05
131 0.05
132 0.05
133 0.07
134 0.08
135 0.09
136 0.11
137 0.11
138 0.13
139 0.12
140 0.13
141 0.14
142 0.18
143 0.21
144 0.25
145 0.27
146 0.26
147 0.28
148 0.28
149 0.3
150 0.27
151 0.35
152 0.35
153 0.35
154 0.35
155 0.39
156 0.42
157 0.39
158 0.35
159 0.25
160 0.21
161 0.19
162 0.19
163 0.16
164 0.11
165 0.11
166 0.11
167 0.1
168 0.08
169 0.11
170 0.12
171 0.11
172 0.13
173 0.15
174 0.16
175 0.2
176 0.2
177 0.21
178 0.25
179 0.32
180 0.33
181 0.35
182 0.35
183 0.33
184 0.34
185 0.34
186 0.36
187 0.31
188 0.31
189 0.33
190 0.34
191 0.34
192 0.34
193 0.4
194 0.43
195 0.49
196 0.57
197 0.62
198 0.71
199 0.82
200 0.9
201 0.91
202 0.91
203 0.93
204 0.94
205 0.94
206 0.94
207 0.93
208 0.91
209 0.89
210 0.87
211 0.85
212 0.84
213 0.84
214 0.83
215 0.84
216 0.82
217 0.8
218 0.82
219 0.83
220 0.82
221 0.8
222 0.78
223 0.74
224 0.71
225 0.66
226 0.62
227 0.58
228 0.55
229 0.48
230 0.43
231 0.37
232 0.39
233 0.44
234 0.43
235 0.37
236 0.35
237 0.39
238 0.4
239 0.43
240 0.4
241 0.39
242 0.38
243 0.41
244 0.38
245 0.36
246 0.34
247 0.35
248 0.37