Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

H1VQN3

Protein Details
Accession H1VQN3   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-37AKNQLLRGPNRRPKRSPRTVVPPVRTHydrophilic
NLS Segment(s)
PositionSequence
20-28PNRRPKRSP
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
Amino Acid Sequences MVHSAFCWSLPAKNQLLRGPNRRPKRSPRTVVPPVRTKLRGTLYPMSHISLQNPIHGRVTRTGVRHKYETNEPITTPGRTIQTNQKPSPAPWIPPAWAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.46
4 0.51
5 0.55
6 0.59
7 0.64
8 0.71
9 0.75
10 0.77
11 0.8
12 0.82
13 0.84
14 0.81
15 0.8
16 0.8
17 0.82
18 0.82
19 0.78
20 0.75
21 0.67
22 0.66
23 0.59
24 0.5
25 0.47
26 0.42
27 0.39
28 0.36
29 0.4
30 0.35
31 0.36
32 0.36
33 0.31
34 0.29
35 0.26
36 0.21
37 0.2
38 0.19
39 0.2
40 0.2
41 0.2
42 0.21
43 0.22
44 0.23
45 0.19
46 0.24
47 0.24
48 0.26
49 0.34
50 0.36
51 0.4
52 0.42
53 0.41
54 0.41
55 0.44
56 0.46
57 0.43
58 0.38
59 0.34
60 0.36
61 0.37
62 0.32
63 0.26
64 0.24
65 0.22
66 0.22
67 0.25
68 0.31
69 0.39
70 0.47
71 0.47
72 0.51
73 0.5
74 0.51
75 0.57
76 0.5
77 0.44
78 0.41
79 0.44