Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5B1QQY6

Protein Details
Accession A0A5B1QQY6    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
71-99DGVVCRRRCRSYCRRRSNPYRARRTSFPQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MLLTFACHTSTHSVQLLCSASWARPAAREPAVLSSAGRLHHRLWVVSRGSRELRALESGENRCGCGCVDVDGVVCRRRCRSYCRRRSNPYRARRTSFPQACTIAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.27
4 0.2
5 0.2
6 0.17
7 0.14
8 0.18
9 0.2
10 0.16
11 0.17
12 0.2
13 0.23
14 0.23
15 0.24
16 0.21
17 0.22
18 0.22
19 0.2
20 0.18
21 0.14
22 0.15
23 0.15
24 0.15
25 0.14
26 0.14
27 0.18
28 0.19
29 0.18
30 0.18
31 0.22
32 0.23
33 0.23
34 0.24
35 0.23
36 0.24
37 0.24
38 0.23
39 0.18
40 0.17
41 0.15
42 0.15
43 0.13
44 0.17
45 0.18
46 0.21
47 0.2
48 0.19
49 0.17
50 0.17
51 0.15
52 0.12
53 0.1
54 0.08
55 0.09
56 0.09
57 0.1
58 0.11
59 0.13
60 0.16
61 0.18
62 0.19
63 0.23
64 0.29
65 0.32
66 0.4
67 0.5
68 0.57
69 0.66
70 0.75
71 0.81
72 0.84
73 0.92
74 0.93
75 0.92
76 0.91
77 0.91
78 0.88
79 0.85
80 0.81
81 0.78
82 0.78
83 0.76
84 0.68
85 0.64