Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5B1QVV0

Protein Details
Accession A0A5B1QVV0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-34LFGISFERRRRQRHASRSRTRGGTHydrophilic
88-109EGRGRERRFRVPRKRLWRQASABasic
NLS Segment(s)
PositionSequence
19-24RRRQRH
90-105RGRERRFRVPRKRLWR
Subcellular Location(s) mito 18, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MHSRKYKLCTLFGISFERRRRQRHASRSRTRGGTLDVDPHARAHVIIREPTGAGAARIPRPDDLRVFAKAERRGTVKLGWCAAICGGEGRGRERRFRVPRKRLWRQASAGGRADRVGAGDLPGRMGFDYGQEAAVGSGRCAGESLEVKRLGSKQGEGVEADVCTCCLTRPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.52
4 0.57
5 0.58
6 0.61
7 0.66
8 0.7
9 0.75
10 0.78
11 0.82
12 0.83
13 0.86
14 0.87
15 0.86
16 0.79
17 0.7
18 0.61
19 0.54
20 0.48
21 0.39
22 0.37
23 0.31
24 0.29
25 0.28
26 0.25
27 0.22
28 0.17
29 0.15
30 0.12
31 0.16
32 0.17
33 0.18
34 0.18
35 0.19
36 0.18
37 0.18
38 0.17
39 0.12
40 0.09
41 0.1
42 0.12
43 0.14
44 0.15
45 0.16
46 0.17
47 0.2
48 0.22
49 0.21
50 0.22
51 0.22
52 0.23
53 0.24
54 0.24
55 0.28
56 0.3
57 0.3
58 0.29
59 0.29
60 0.28
61 0.28
62 0.3
63 0.28
64 0.25
65 0.24
66 0.22
67 0.19
68 0.18
69 0.16
70 0.12
71 0.08
72 0.06
73 0.06
74 0.07
75 0.07
76 0.1
77 0.17
78 0.19
79 0.23
80 0.26
81 0.35
82 0.44
83 0.54
84 0.62
85 0.65
86 0.73
87 0.8
88 0.86
89 0.86
90 0.83
91 0.79
92 0.71
93 0.7
94 0.66
95 0.61
96 0.55
97 0.46
98 0.4
99 0.33
100 0.3
101 0.21
102 0.16
103 0.12
104 0.07
105 0.08
106 0.09
107 0.09
108 0.1
109 0.1
110 0.09
111 0.08
112 0.09
113 0.08
114 0.07
115 0.1
116 0.09
117 0.09
118 0.08
119 0.09
120 0.08
121 0.11
122 0.1
123 0.07
124 0.11
125 0.11
126 0.11
127 0.11
128 0.11
129 0.13
130 0.18
131 0.21
132 0.24
133 0.25
134 0.25
135 0.29
136 0.3
137 0.3
138 0.29
139 0.27
140 0.26
141 0.28
142 0.3
143 0.26
144 0.26
145 0.22
146 0.19
147 0.18
148 0.14
149 0.11
150 0.1
151 0.1