Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H1VAV7

Protein Details
Accession H1VAV7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
248-267LVLRRRAARRRERPGAVPPDBasic
NLS Segment(s)
PositionSequence
252-263RRRAARRRERPG
Subcellular Location(s) plas 17, mito 7, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011701  MFS  
IPR020846  MFS_dom  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF07690  MFS_1  
PROSITE View protein in PROSITE  
PS50850  MFS  
Amino Acid Sequences MATHPDPAEVEMAAAPGPPRATSTAAAAKDGDPFLVDFARPYDAENPLDWPAGRKWMVTDVLSATGFNRIMVSTIMAPALTNIAAELDMTAXESAMALSIYLLATALGPLVIGPLSEIYGRQVVLHASSAWFLVWNVLCGFATTKGTLIAARFLAGFGASAIYALGGGVLGDIWRPEQRGRSMGVYLLIPLLGAAVGECPVRPPVSGPIIGGFIAARTTWRWMFWSTSIFQAAMIFVSLFSFPESYGALVLRRRAARRRERPGAVPPDAHGRAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.1
5 0.1
6 0.12
7 0.14
8 0.17
9 0.17
10 0.23
11 0.28
12 0.28
13 0.29
14 0.28
15 0.26
16 0.26
17 0.25
18 0.19
19 0.13
20 0.12
21 0.13
22 0.13
23 0.12
24 0.09
25 0.11
26 0.13
27 0.13
28 0.15
29 0.18
30 0.2
31 0.22
32 0.22
33 0.23
34 0.22
35 0.24
36 0.21
37 0.21
38 0.19
39 0.24
40 0.24
41 0.21
42 0.21
43 0.24
44 0.27
45 0.24
46 0.24
47 0.18
48 0.2
49 0.2
50 0.18
51 0.14
52 0.14
53 0.14
54 0.12
55 0.11
56 0.09
57 0.1
58 0.1
59 0.11
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.06
66 0.07
67 0.05
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.03
79 0.03
80 0.03
81 0.03
82 0.02
83 0.02
84 0.02
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.02
94 0.02
95 0.02
96 0.03
97 0.02
98 0.02
99 0.03
100 0.03
101 0.04
102 0.04
103 0.04
104 0.05
105 0.06
106 0.06
107 0.06
108 0.07
109 0.06
110 0.07
111 0.08
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.05
118 0.05
119 0.06
120 0.06
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.08
127 0.07
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.08
134 0.07
135 0.08
136 0.07
137 0.07
138 0.07
139 0.06
140 0.06
141 0.05
142 0.05
143 0.03
144 0.04
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.03
159 0.04
160 0.05
161 0.07
162 0.09
163 0.14
164 0.16
165 0.18
166 0.21
167 0.22
168 0.21
169 0.2
170 0.2
171 0.16
172 0.13
173 0.11
174 0.09
175 0.06
176 0.05
177 0.04
178 0.03
179 0.03
180 0.02
181 0.03
182 0.04
183 0.04
184 0.04
185 0.05
186 0.07
187 0.08
188 0.08
189 0.1
190 0.14
191 0.18
192 0.19
193 0.18
194 0.18
195 0.18
196 0.18
197 0.16
198 0.11
199 0.07
200 0.07
201 0.06
202 0.07
203 0.07
204 0.12
205 0.12
206 0.13
207 0.16
208 0.18
209 0.21
210 0.23
211 0.26
212 0.23
213 0.25
214 0.26
215 0.23
216 0.21
217 0.18
218 0.15
219 0.11
220 0.1
221 0.07
222 0.06
223 0.07
224 0.07
225 0.06
226 0.07
227 0.08
228 0.07
229 0.09
230 0.09
231 0.09
232 0.1
233 0.11
234 0.13
235 0.15
236 0.19
237 0.24
238 0.3
239 0.36
240 0.43
241 0.53
242 0.61
243 0.69
244 0.76
245 0.79
246 0.79
247 0.79
248 0.8
249 0.79
250 0.72
251 0.63
252 0.55
253 0.55
254 0.51